Basic Vector Information
- Vector Name:
- pZH3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5832 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Hu JC.
- Promoter:
- tet
pZH3 vector Map
pZH3 vector Sequence
LOCUS 40924_48393 5832 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pZH3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5832) AUTHORS Hu JC. TITLE Repressor fusions as a tool to study protein-protein interactions JOURNAL Structure 3 (5), 431-433 (1995) PUBMED 7663940 REFERENCE 2 (bases 1 to 5832) AUTHORS Zhu H, Celinski SA, Scholtz JM, Hu JC. TITLE The contribution of buried polar groups to the conformational stability of the GCN4 coiled coil JOURNAL Unpublished REFERENCE 3 (bases 1 to 5832) AUTHORS Zhu H, Celinski SA, Scholtz JM, Hu JC. TITLE Direct Submission JOURNAL REFERENCE 4 (bases 1 to 5832) TITLE Direct Submission REFERENCE 5 (bases 1 to 5832) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Structure"; date: "1995"; volume: "3"; issue: "5"; pages: "431-433" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (13-JUL-1999) Biochemistry " COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..5832 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 12..40 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" terminator complement(408..455) /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(525..590) /codon_start=1 /label=GCN4_v1 /note="GCN4 peptide that allows binding to an scFv-GFP fusion protein (Tanenbaum et al., 2014)" /translation="LLSKNYHLENEVARLKKLVGER" CDS complement(2497..2535) /codon_start=1 /product="expressed peptide start" /label=expressed peptide start /protein_id="AAD50824.1" /translation="MSTDRSRRFTTS" RBS complement(2543..2565) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" promoter complement(2597..2615) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 3386..3574 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 3679..3821 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(4007..4595) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4769..5626) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(5627..5731) /label=AmpR promoter
This page is informational only.