Basic Vector Information
- Vector Name:
- pYFP-TAF28-CFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6833 bp
- Type:
- Yeast integrative vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Bonomi M, Muller EGD., Pellarin R, Kim SJ, Russel D, Ramsden R, Sundin BA, Davis TN, Sali A.
- Promoter:
- TEF1
pYFP-TAF28-CFP vector Map
pYFP-TAF28-CFP vector Sequence
LOCUS 40924_48093 6833 bp DNA circular SYN 18-DEC-2018 DEFINITION Yeast integrative vector pYFP-TAF28-CFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6833) AUTHORS Bonomi M, Muller EGD., Pellarin R, Kim SJ, Russel D, Ramsden R, Sundin BA, Davis TN, Sali A. TITLE Protein complex structures from Bayesian modeling of in vivo FRET data JOURNAL Unpublished REFERENCE 2 (bases 1 to 6833) AUTHORS Bonomi M, Muller EGD., Pellarin R, Kim SJ, Russel D, Ramsden R, Sundin BA, Davis TN, Sali A. TITLE Direct Submission JOURNAL Submitted (31-MAY-2013) Biochemistry, University of Washington, 1705 NE Pacific St, Seattle, WA 98195-7350, USA REFERENCE 3 (bases 1 to 6833) TITLE Direct Submission REFERENCE 4 (bases 1 to 6833) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAY-2013) Biochemistry, University of Washington, 1705 NE Pacific St, Seattle, WA 98195-7350, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Main Workbench v. 6 Sequencing Technology :: Sanger dideoxy sequencing; Genbank ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6833 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..20 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 35..431 /label=TEF1 promoter /note="promoter for EF-1-alpha" CDS 467..487 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" CDS 497..517 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" CDS 521..541 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" CDS 551..1267 /codon_start=1 /label=EYFP /note="enhanced YFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFGYGLKCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITHGMDELYK" terminator 2397..2586 /label=CYC1 terminator /note="transcription terminator for CYC1" promoter complement(2609..2627) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2648..2664) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2672..2688) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2696..2726) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2741..2762) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3050..3638) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3812..4669) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4670..4774) /label=AmpR promoter promoter 5059..5279 /label=URA3 promoter CDS 5280..6080 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" rep_origin complement(6212..6667) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 6812..6828 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.