Basic Vector Information
- Vector Name:
- pYD14
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8248 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Deng Y, Olson DG, Zhou J, Herring CD, Joe Shaw A, Lynd LR.
pYD14 vector Vector Map
pYD14 vector Sequence
LOCUS V001906 8248 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V001906 VERSION V001906 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8248) AUTHORS Deng Y, Olson DG, Zhou J, Herring CD, Joe Shaw A, Lynd LR. TITLE Redirecting carbon flux through exogenous pyruvate kinase to achieve high ethanol yields in Clostridium thermocellum JOURNAL Metab. Eng. 15, 151-158 (2013) PUBMED 23202749 REFERENCE 2 (bases 1 to 8248) AUTHORS Zhou J, Olson DG, Lynd LR. TITLE Direct Submission JOURNAL Submitted (05-NOV-2013) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, U.S REFERENCE 3 (bases 1 to 8248) TITLE Direct Submission REFERENCE 4 (bases 1 to 8248) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Metab. Eng. 15, 151-158 (2013)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-NOV-2013) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, U.S" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8248 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(1..455) /direction=LEFT /label="Clostridium thermocellum" /note="Clostridium thermocellum" CDS complement(561..1418) /label="AmpR" /note="beta-lactamase" promoter complement(1419..1523) /label="AmpR promoter" misc_feature 1613..2012 /label="similar to Clo1313_1879" /note="similar to Clo1313_1879" regulatory 2016..2590 /gene="GAPDH" /regulatory_class="promoter" gene 2016..2590 /gene="GAPDH" /label="GAPDH" CDS 2591..3238 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 3259..3804 /codon_start=1 /locus_tag="or0940" /product="hypoxanthine phosphoribosyl transferase" /EC_number="2.4.2.8" /label="or0940" /protein_id="AHH35087.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 3259..3804 /locus_tag="or0940" /label="or0940" regulatory 3819..3858 /label="hairpin" /note="hairpin" /regulatory_class="terminator" misc_feature 4391..4813 /label="similar to Clo1313_1879" /note="similar to Clo1313_1879" terminator 4846..5034 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(5294..5882) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5969..6547) /codon_start=1 /gene="tdk" /locus_tag="or0326" /product="thymidine kinase" /EC_number="2.7.1.21" /label="tdk" /protein_id="AHH35090.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(5969..6547) /gene="tdk" /locus_tag="or0326" /label="tdk" regulatory complement(6548..7168) /gene="cbp" /regulatory_class="promoter" gene complement(6548..7168) /gene="cbp" /label="cbp" CDS complement(7247..8248) /label="repB" /note="RepB replication protein"
This page is informational only.