Basic Vector Information
- Vector Name:
- pYC46
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6018 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Yanez Carrillo P, Castano Navarro I.
- Promoter:
- TEF
pYC46 vector Map
pYC46 vector Sequence
LOCUS 40924_47918 6018 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pYC46, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6018) AUTHORS Yanez Carrillo P, Castano Navarro I. TITLE Expression vectors for C-terminal fusions with fluorescent proteins and epitope tags in C. glabrata JOURNAL Unpublished REFERENCE 2 (bases 1 to 6018) AUTHORS Yanez Carrillo P, Castano Navarro I. TITLE Direct Submission JOURNAL Submitted (05-DEC-2014) Division de Biologia Molecular, Instituto Potosino de Investigacion Cientifica y Tecnologica, Camino a la Presa San Jose 2055 Col. Lomas 4 seccion, San Luis Potosi 78216, Mexico REFERENCE 3 (bases 1 to 6018) TITLE Direct Submission REFERENCE 4 (bases 1 to 6018) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-DEC-2014) Division de Biologia Molecular, Instituto Potosino de Investigacion Cientifica y Tecnologica, Camino a la Presa San Jose 2055 Col. Lomas 4 seccion, San Luis Potosi 78216, Mexico" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6018 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 190..410 /label=URA3 promoter CDS 411..1211 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" rep_origin complement(1343..1798) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 1943..1959 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 1966..1984 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 2017..2033 /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS 2043..2066 /codon_start=1 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" /translation="DYKDDDDK" CDS 2073..2096 /codon_start=1 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" /translation="DYKDDDDK" CDS 2103..2126 /codon_start=1 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" /translation="DYKDDDDK" misc_feature 2138..2171 /label=FRT sequence /note="FRT sequence" protein_bind complement(2138..2171) /label=FRT (minimal) /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" 3'UTR 2172..2460 /label=3'UTR of CTA1 orf in Candida glabrata BG2 /note="3'UTR of CTA1 orf in Candida glabrata BG2" promoter 2501..2844 /label=TEF promoter /note="Ashbya gossypii TEF promoter" CDS 2868..3431 /codon_start=1 /label=NrsR /note="nourseothricin acetyltransferase" /translation="TTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTL REVPVDPPLTKVFPDDESDDESDAGEDGDPDSRTFVAYGDDGDLAGFVVVSYSGWNRRL TVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTLC GLDTALYDGTASDGEQALYMSMPCP" terminator 3448..3645 /label=TEF terminator /note="Ashbya gossypii TEF terminator" protein_bind complement(3688..3721) /label=FRT (minimal) /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" promoter complement(3758..3776) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(3797..3813) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3821..3837) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3845..3875) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3890..3911) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4199..4787) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4961..5818) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(5819..5923) /label=AmpR promoter
This page is informational only.