pXZ240 vector (V002006)

LOCUS       40924_47398        7014 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pXZ240, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 5 to 48)
  AUTHORS   Zeng X, Herndon AM, Hu JC.
  TITLE     Buried asparagines determine the dimerization specificities of 
            leucine zipper mutants
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 94 (8), 3673-3678 (1997)
  PUBMED    9108036
REFERENCE   2  (bases 1 to 7014)
  AUTHORS   Marino-Ramirez L, Hu JC.
  TITLE     Using lambda repressor fusions to isolate and characterize 
            self-assembling domains
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7014)
  AUTHORS   Marino-Ramirez L, Hu JC.
  TITLE     Direct Submission
  JOURNAL   
REFERENCE   4  (bases 1 to 7014)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 7014)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "1997"; volume: "94"; issue: "8"; pages: 
            "3673-3678"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (25-OCT-2000) Biochemistry "
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7014
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      5..48
                     /note="HH7107; weak constitutive promoter derived from
                     lacUV5"
                     /citation=[1]
                     /regulatory_class="promoter"
     CDS             73..501
                     /codon_start=1
                     /product="cI binding domain"
                     /label=cI binding domain
                     /note="cI-DBD"
                     /protein_id="AAK07890.1"
                     /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
                     SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
                     PVFSHVQAGMFSPKLRTFTKGDAERWVSTDRSRRFTTS"
     CDS             2408..2473
                     /label=GCN4_v1
                     /note="GCN4 peptide that allows binding to an scFv-GFP
                     fusion protein (Tanenbaum et al., 2014)"
     terminator      2543..2590
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     CDS             4075..4263
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     misc_feature    4368..4508
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(4694..5282)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      5393..5906
                     /label=M13 ori
                     /note="M13 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     CDS             complement(5951..6808)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(6809..6913)
                     /label=AmpR promoter