Basic Vector Information
- Vector Name:
- pXtale
- Antibiotic Resistance:
- Gentamycin
- Length:
- 6416 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Pesce C, Koebnik R.
- Promoter:
- Pc
pXtale vector Vector Map
pXtale vector Sequence
LOCUS 40924_47348 6416 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pXtale, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6416) AUTHORS Pesce C, Koebnik R. TITLE TALE expression vector for clade-1 xanthomonads JOURNAL Unpublished REFERENCE 2 (bases 1 to 6416) AUTHORS Pesce C, Koebnik R. TITLE Direct Submission JOURNAL Submitted (25-JAN-2017) UMR 186 IPME, IRD Montpellier, 911, Avenue Agropolis, Montpellier, Languedoc-Roussillon 34394, France REFERENCE 3 (bases 1 to 6416) TITLE Direct Submission REFERENCE 4 (bases 1 to 6416) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-JAN-2017) UMR 186 IPME, IRD Montpellier, 911, Avenue Agropolis, Montpellier, Languedoc-Roussillon 34394, France" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6416 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 1023..1792 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 1793..2452 /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" primer_bind 3162..3178 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3188..3206 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS complement(3245..4912) /codon_start=1 /gene="TAL" /product="TAL effector repeat array acceptor" /label=TAL /note="TAL effector derivative without repeat array" /protein_id="ASM90837.1" /translation="MEPIRSRTPSTARELQAGSQPDAVQPIADRLVSTPASSPLDGLPA RRMVSRTSPPPSPARSPAFSAGSLSGLLRQQIDPSLFAGSPFDSLPSFGAARAESAPGE GDEVQSALRAVDDPQPSASAAITAAPPRTKAAARRRSAQTSDALPAAHVDLGTFGYSQQ QQEKIKPKVRSTVAQHHEALVGHGFTHAHIVELSKHPPALGTIAARYSEMIAALPEATH EDIVGVGKQKSGARALEALLTVAEELRAPPLQLVTGQLLKIAKRGGVNAVEVRPASSST RVSPDPALAALTNDRLVALACLGGRPALDAVKKGLPHAPALVTRTHNRVPEGTAHLVAD HAQVVRVLGFFQCHSHPAQAFHEAMTRFEMSREGLLQLFRRVGVTELEAISGTLPPASQ RWHRILQALGVKGAKPSSASAQTPSQESVDAFADSLERELDAPSPIHEADRARASNRKR SRSESSVNRSSAQQAAEVFVPEQRDAPPLLPLSSWGVKRQRTRIGGLPDPGMPTDGELA ASSAAFLEQDADPFAGAAEDFPVFDQEEIAWLMTLLPH" primer_bind complement(4937..4953) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(4983..5001) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(5022..5038) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5046..5062) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5070..5100) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(5115..5136) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 5406..5434 /label=Pc promoter /note="class 1 integron promoter" CDS 5623..6153 /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT"
This page is informational only.