Basic Vector Information
- Vector Name:
- pXT99A
- Length:
- 4855 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kirchner O, Tauch A.
pXT99A vector Map
pXT99A vector Sequence
LOCUS 40924_47343 4855 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pXT99A, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4855)
AUTHORS Kirchner O, Tauch A.
TITLE Tools for genetic engineering in the amino acid-producing bacterium
Corynebacterium glutamicum
JOURNAL J. Biotechnol. 104 (1-3), 287-299 (2003)
PUBMED 12948646
REFERENCE 2 (bases 1 to 4855)
AUTHORS Kirchner O, Tauch A.
TITLE Direct Submission
JOURNAL Submitted (15-JAN-2003) Department of Genetics, University of
Bielefeld, Universitaetsstrasse 25, Bielefeld D-33615, Germany
REFERENCE 3 (bases 1 to 4855)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4855)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J.
Biotechnol. 104 (1-3), 287-299 (2003)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-JAN-2003) Department of Genetics, University of Bielefeld,
Universitaetsstrasse 25, Bielefeld D-33615, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4855
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..57
/label=MCS
/note="pUC18/19 multiple cloning site"
terminator 260..346
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 438..465
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
CDS complement(997..1008)
/codon_start=1
/label=Factor Xa site
/note="Factor Xa recognition and cleavage site"
/translation="IEGR"
rep_origin 2287..2875
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(3061..3201)
/label=bom
/note="basis of mobility region from pBR322"
promoter 3387..3464
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 3465..4544
/codon_start=1
/label=lacI
/note="lac repressor"
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
ALADSLMQLARQVSRLESGQ"
promoter 4779..4808
/label=trc promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind 4816..4832
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.