pXoom-AQP4d vector (V002028)

LOCUS       40924_47248        5829 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pXoom-AQP4d, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5829)
  AUTHORS   Moe SE, Sorbo JG, Sogaard R, Zeuthen T, Petter Ottersen O, Holen T.
  TITLE     New isoforms of rat Aquaporin-4
  JOURNAL   Genomics 91 (4), 367-377 (2008)
  PUBMED    18255256
REFERENCE   2  (bases 1 to 5829)
  AUTHORS   Sorbo JG, Moe SE, Holen TV.
  TITLE     New Isoforms of Rat Aquaporin-4
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 5829)
  AUTHORS   Sorbo JG, Moe SE, Holen TV.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-FEB-2007) CMBN, University of Oslo, Sognsvannsveien 9,
            Oslo, no 0317, Norway
REFERENCE   4  (bases 1 to 5829)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 5829)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Genomics"; 
            date: "2008"; volume: "91"; issue: "4"; pages: "367-377"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (11-FEB-2007) CMBN, University of Oslo, Sognsvannsveien 9, Oslo, no 
            0317, Norway"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5829
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        224..603
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        604..807
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        852..870
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     5'UTR           903..945
                     /label=Xenopus globin 5'-UTR
                     /note="translational enhancer from the 5'-UTR of the major 
                     beta-globin gene of Xenopus laevis"
     regulatory      974..983
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     regulatory      978..987
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             980..1720
                     /codon_start=1
                     /product="AQP4d"
                     /label=AQP4d
                     /note="aquaporin-4 isoform; derived from Rattus norvegicus 
                     strain PVG"
                     /protein_id="ABO09755.1"
                     /translation="MVAFKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTINWGGSENPLP
                     VDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYITAQCLGA
                     IIGAGILYLVTPPSVVGGLGVTTINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
                     AVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVV
                     HVIDIDRGDEKKGKDSSGEVLSSV"
     regulatory      1157..1166
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     3'UTR           1800..1925
                     /label=Xenopus globin 3'-UTR
                     /note="3'-UTR of the major beta-globin gene of Xenopus
                     laevis"
     polyA_signal    2071..2295
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      2341..2769
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        2783..3113
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     promoter        3161..3208
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             3227..3931
                     /label=EGFP
                     /note="enhanced GFP"
     CDS             3938..4726
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     polyA_signal    4903..5036
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(5166..5754)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"