Basic Vector Information
- Vector Name:
- pXB173-lux
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10266 bp
- Type:
- Shuttle vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Bina XR, Miller MA, Bina JE.
pXB173-lux vector Vector Map
pXB173-lux vector Sequence
LOCUS 40924_47113 10266 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pXB173-lux, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10266) AUTHORS Bina XR, Miller MA, Bina JE. TITLE Construction of a bioluminescence reporter plasmid for Francisella tularensis JOURNAL Plasmid 64 (3), 156-161 (2010) PUBMED 20620161 REFERENCE 2 (bases 1 to 10266) AUTHORS Bina JE. TITLE Direct Submission JOURNAL Submitted (21-MAR-2010) Molecular Sciences, The University of Tennessee HSC, Memphis, TN 38163, USA REFERENCE 3 (bases 1 to 10266) TITLE Direct Submission REFERENCE 4 (bases 1 to 10266) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2010"; volume: "64"; issue: "3"; pages: "156-161" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-MAR-2010) Molecular Sciences, The University of Tennessee HSC, Memphis, TN 38163, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10266 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory complement(2..185) /label=repA promoter /note="repA promoter" /regulatory_class="promoter" regulatory 186..372 /label=orf5 promoter /note="orf5 promoter" /regulatory_class="promoter" CDS 418..1230 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin complement(1319..1707) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" oriT 1878..1987 /label=oriT /note="incP origin of transfer" regulatory 2088..2305 /label=Francisella tularensis gro promoter /note="Francisella tularensis gro promoter" /regulatory_class="promoter" CDS 2382..3821 /label=LuxC /note="LuxC fatty acid reductase" CDS 3837..4757 /label=LuxD /note="LuxD acyltransferase" CDS 4809..5888 /label=LuxA /note="LuxA luciferase subunit" CDS 5906..6886 /label=LuxB /note="LuxB luciferase subunit" CDS 7068..8177 /label=LuxE /note="LuxE" CDS complement(8823..9245) /codon_start=1 /gene="repB" /product="RepB" /label=repB /protein_id="ADI49667.1" /translation="MNIEIFKFSKKHKKINKKLIDLTKVKQVVTTGYSFIVVYQRGRKI ELSYESSYWHAKKDLDNSNSDVGITYSYIKKDKRGPCHKDNYLRDSKGRLLKDWGKIEE LHEKYPKIGKIWYISREETDKLLKDFTYKNGNLIMV" gene complement(8823..9245) /gene="repB" /label=repB
This page is informational only.