pXB173-lux vector (V002055)

Download GeneBank File(.gb)

LOCUS       40924_47113       10266 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pXB173-lux, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10266)
  AUTHORS   Bina XR, Miller MA, Bina JE.
  TITLE     Construction of a bioluminescence reporter plasmid for Francisella 
            tularensis
  JOURNAL   Plasmid 64 (3), 156-161 (2010)
  PUBMED    20620161
REFERENCE   2  (bases 1 to 10266)
  AUTHORS   Bina JE.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2010) Molecular Sciences, The University of 
            Tennessee HSC, Memphis, TN 38163, USA
REFERENCE   3  (bases 1 to 10266)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10266)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; 
            date: "2010"; volume: "64"; issue: "3"; pages: "156-161"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-MAR-2010) Molecular Sciences, The University of Tennessee HSC, 
            Memphis, TN 38163, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10266
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      complement(2..185)
                     /label=repA promoter
                     /note="repA promoter"
                     /regulatory_class="promoter"
     regulatory      186..372
                     /label=orf5 promoter
                     /note="orf5 promoter"
                     /regulatory_class="promoter"
     CDS             418..1230
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     rep_origin      complement(1319..1707)
                     /direction=LEFT
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     oriT            1878..1987
                     /label=oriT
                     /note="incP origin of transfer"
     regulatory      2088..2305
                     /label=Francisella tularensis gro promoter
                     /note="Francisella tularensis gro promoter"
                     /regulatory_class="promoter"
     CDS             2382..3821
                     /label=LuxC
                     /note="LuxC fatty acid reductase"
     CDS             3837..4757
                     /label=LuxD
                     /note="LuxD acyltransferase"
     CDS             4809..5888
                     /label=LuxA
                     /note="LuxA luciferase subunit"
     CDS             5906..6886
                     /label=LuxB
                     /note="LuxB luciferase subunit"
     CDS             7068..8177
                     /label=LuxE
                     /note="LuxE"
     CDS             complement(8823..9245)
                     /codon_start=1
                     /gene="repB"
                     /product="RepB"
                     /label=repB
                     /protein_id="ADI49667.1"
                     /translation="MNIEIFKFSKKHKKINKKLIDLTKVKQVVTTGYSFIVVYQRGRKI
                     ELSYESSYWHAKKDLDNSNSDVGITYSYIKKDKRGPCHKDNYLRDSKGRLLKDWGKIEE
                     LHEKYPKIGKIWYISREETDKLLKDFTYKNGNLIMV"
     gene            complement(8823..9245)
                     /gene="repB"
                     /label=repB