pWY107 vector (V002069)

LOCUS       40924_46903        5818 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pWY107, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5818)
  AUTHORS   Rozwadowski K, Yang W, Kagale S.
  TITLE     Homologous recombination-mediated cloning and manipulation of 
            genomic DNA regions using Gateway and recombineering systems
  JOURNAL   BMC Biotechnol. 8, 88 (2008)
  PUBMED    19014699
REFERENCE   2  (bases 1 to 5818)
  AUTHORS   Rozwadowski KL, Yang W, Kagale S.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-OCT-2008) Molecular Genetics, Agriculture and 
            Agri-Food Canada, 107 Science Place, Saskatoon, Saskatchewan S7N 
            0X2, Canada
REFERENCE   3  (bases 1 to 5818)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5818)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "BMC 
            Biotechnol. 8, 88 (2008)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (21-OCT-2008) Molecular Genetics, Agriculture and Agri-Food Canada, 
            107 Science Place, Saskatoon, Saskatchewan S7N 0X2, Canada"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5818
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(106..130)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     regulatory      231..733
                     /label=tCUP2 promoter
                     /note="tCUP2 promoter"
                     /regulatory_class="promoter"
     CDS             779..1570
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     terminator      1647..1899
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     primer_bind     complement(1916..1932)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    complement(2013..2037)
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     rep_origin      2115..2746
                     /label=oriV
                     /note="incP origin of replication"
     CDS             3589..4263
                     /codon_start=1
                     /gene="aad9"
                     /product="Aad9"
                     /label=aad9
                     /protein_id="ACL35312.1"
                     /translation="MFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI
                     GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLY
                     QAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILT
                     MDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLK
                     KL"
     gene            3589..4263
                     /gene="aad9"
                     /label=aad9
     CDS             4624..5769
                     /label=trfA
                     /note="trans-acting replication protein that binds to and 
                     activates oriV"