Basic Vector Information
- Vector Name:
- pWY102
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3030 bp
- Type:
- Gateway Entry vector
- Replication origin:
- ori
- Source/Author:
- Rozwadowski K, Yang W, Kagale S.
pWY102 vector Map
pWY102 vector Sequence
LOCUS 40924_46898 3030 bp DNA circular SYN 18-DEC-2018 DEFINITION Gateway Entry vector pWY102, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3030) AUTHORS Rozwadowski K, Yang W, Kagale S. TITLE Homologous recombination-mediated cloning and manipulation of genomic DNA regions using Gateway and recombineering systems JOURNAL BMC Biotechnol. 8, 88 (2008) PUBMED 19014699 REFERENCE 2 (bases 1 to 3030) AUTHORS Rozwadowski KL, Yang W, Kagale S. TITLE Direct Submission JOURNAL Submitted (21-OCT-2008) Molecular Genetics, Agriculture and Agri-Food Canada, 107 Science Place, Saskatoon, Saskatchewan S7N 0X2, Canada REFERENCE 3 (bases 1 to 3030) TITLE Direct Submission REFERENCE 4 (bases 1 to 3030) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC Biotechnol. 8, 88 (2008)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-OCT-2008) Molecular Genetics, Agriculture and Agri-Food Canada, 107 Science Place, Saskatoon, Saskatchewan S7N 0X2, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3030 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 67..166 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS 209..919 /codon_start=1 /label=mgfp5 /note="GFP with folding enhancement mutations" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKAN FKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELYK" protein_bind complement(968..1067) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 1190..1996 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVSLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2089..2677 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator 2842..2928 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3020..3030 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene"
This page is informational only.