Basic Vector Information
- Vector Name:
- pWW3840
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4819 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Whitaker WR, Shepherd ES, Sonnenburg JL.
pWW3840 vector Map
pWW3840 vector Sequence
LOCUS 40924_46798 4819 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pWW3840, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4819) AUTHORS Whitaker WR, Shepherd ES, Sonnenburg JL. TITLE Tunable expression tools enable single-cell strain distinction in the gut microbiome JOURNAL Cell (2017) In press REFERENCE 2 (bases 1 to 4819) AUTHORS Whitaker WR, Shepherd ES, Sonnenburg JL. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 4819) TITLE Direct Submission REFERENCE 4 (bases 1 to 4819) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-MAR-2017) Microbiology " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4819 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 18..530 /label=Nluc /note="NanoLuc(R) luciferase" terminator 553..580 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" CDS complement(812..2095) /codon_start=1 /product="NBU integrase" /label=NBU integrase /protein_id="ARI71385.1" /translation="MNIKRNIIFALESRKKNGVPIVENVPIRMRVIFASQRIEFTTGYR IDVAKWDADKQRVKSGCTNKLKQSAAEINTDLLKYYAEIQNIFKEFEVQEVMPTTQQLK EAFNMRMKDTSEEQPEEAPVSFWEVFDEFVKECGNQNNWTASTYEKFAAVRNHLKEFKE DATFNYFNEFGLNEYVNFLRDTKDMRNSTIGKQMGFLKWFLRWSFKKGHHQNIAYDTFK PKLKTTSKKVIFLTWDELNKLKDYQIPKDKQYLERVRDVFLFCCFTSLRYSDVRNLKRS DVKSDHIEITTVKTADSLTIELNKYSKAILDKYKDIHFENYMALPVISNQKMNDYLKEL GELAEINEPVRETYYKGNERIDEVTPKYALLSTHAGRRTFICNALALGIPAQVVMKWTG HSDYKAMKPYIDIADDIKANAMNKFNQL" misc_feature 2255..2266 /label=integration site /note="integration site" misc_feature 2534..3131 /label=split antibiotic resistance marker /note="split antibiotic resistance marker" terminator 3147..3173 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" regulatory 3148..3177 /regulatory_class="terminator" rep_origin complement(3279..3867) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 3945..4048 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 4049..4705 /label=CmR /note="chloramphenicol acetyltransferase" terminator 4779..4813 /label=lambda t0 terminator /note="minimal transcription terminator from phage lambda (Scholtissek and Grosse, 1987)"
This page is informational only.