Basic Vector Information
- Vector Name:
- pWW3827
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5119 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Whitaker WR, Shepherd ES, Sonnenburg JL.
pWW3827 vector Map
pWW3827 vector Sequence
LOCUS 40924_46783 5119 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pWW3827, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5119) AUTHORS Whitaker WR, Shepherd ES, Sonnenburg JL. TITLE Tunable expression tools enable single-cell strain distinction in the gut microbiome JOURNAL Cell (2017) In press REFERENCE 2 (bases 1 to 5119) AUTHORS Whitaker WR, Shepherd ES, Sonnenburg JL. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 5119) TITLE Direct Submission REFERENCE 4 (bases 1 to 5119) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-MAR-2017) Microbiology " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5119 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 18..731 /label=superfolder GFP /note="GFP variant that folds robustly even when fused to poorly folded proteins (Pedelacq et al., 2006)" CDS 738..761 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 762..785 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 786..809 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 813..830 /label=6xHis /note="6xHis affinity tag" terminator 853..880 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" CDS complement(1112..2395) /codon_start=1 /product="NBU integrase" /label=NBU integrase /protein_id="ARI71377.1" /translation="MNIKRNIIFALESRKKNGVPIVENVPIRMRVIFASQRIEFTTGYR IDVAKWDADKQRVKSGCTNKLKQSAAEINTDLLKYYAEIQNIFKEFEVQEVMPTTQQLK EAFNMRMKDTSEEQPEEAPVSFWEVFDEFVKECGNQNNWTASTYEKFAAVRNHLKEFKE DATFNYFNEFGLNEYVNFLRDTKDMRNSTIGKQMGFLKWFLRWSFKKGHHQNIAYDTFK PKLKTTSKKVIFLTWDELNKLKDYQIPKDKQYLERVRDVFLFCCFTSLRYSDVRNLKRS DVKSDHIEITTVKTADSLTIELNKYSKAILDKYKDIHFENYMALPVISNQKMNDYLKEL GELAEINEPVRETYYKGNERIDEVTPKYALLSTHAGRRTFICNALALGIPAQVVMKWTG HSDYKAMKPYIDIADDIKANAMNKFNQL" misc_feature 2555..2566 /label=integration site /note="integration site" misc_feature 2834..3431 /label=split antibiotic resistance marker /note="split antibiotic resistance marker" terminator 3447..3473 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" regulatory 3448..3477 /regulatory_class="terminator" rep_origin complement(3579..4167) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 4245..4348 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 4349..5005 /label=CmR /note="chloramphenicol acetyltransferase" terminator 5079..5113 /label=lambda t0 terminator /note="minimal transcription terminator from phage lambda (Scholtissek and Grosse, 1987)"
This page is informational only.