Basic Vector Information
- Vector Name:
- pWW3406
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5977 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Whitaker WR, Shepherd ES, Sonnenburg JL.
pWW3406 vector Map
pWW3406 vector Sequence
LOCUS 40924_46728 5977 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pWW3406, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5977) AUTHORS Whitaker WR, Shepherd ES, Sonnenburg JL. TITLE Tunable expression tools enable single-cell strain distinction in the gut microbiome JOURNAL Cell (2017) In press REFERENCE 2 (bases 1 to 5977) AUTHORS Whitaker WR, Shepherd ES, Sonnenburg JL. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 5977) TITLE Direct Submission REFERENCE 4 (bases 1 to 5977) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-MAR-2017) Microbiology " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5977 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(29..417) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" oriT 588..697 /label=oriT /note="incP origin of transfer" regulatory 841..933 /regulatory_class="promoter" misc_RNA 939..989 /label=sTRSV HHRz /note="hammerhead ribozyme from the tobacco ringspot virus satellite RNA (Khvorova et al., 2003)" regulatory 1014..1036 /regulatory_class="ribosome_binding_site" CDS 1037..1750 /label=superfolder GFP /note="GFP variant that folds robustly even when fused to poorly folded proteins (Pedelacq et al., 2006)" CDS 1757..1780 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 1781..1804 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 1805..1828 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 1832..1849 /label=6xHis /note="6xHis affinity tag" terminator 1872..1899 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" CDS complement(2131..3414) /codon_start=1 /product="NBU integrase" /label=NBU integrase /protein_id="ARI71341.1" /translation="MNIKRNIIFALESRKKNGVPIVENVPIRMRVIFASQRIEFTTGYR IDVAKWDADKQRVKSGCTNKLKQSAAEINTDLLKYYAEIQNIFKEFEVQEVMPTTQQLK EAFNMRMKDTSEEQPEEAPVSFWEVFDEFVKECGNQNNWTASTYEKFAAVRNHLKEFKE DATFNYFNEFGLNEYVNFLRDTKDMRNSTIGKQMGFLKWFLRWSFKKGHHQNIAYDTFK PKLKTTSKKVIFLTWDELNKLKDYQIPKDKQYLERVRDVFLFCCFTSLRYSDVRNLKRS DVKSDHIEITTVKTADSLTIELNKYSKAILDKYKDIHFENYMALPVISNQKMNDYLKEL GELAEINEPVRETYYKGNERIDEVTPKYALLSTHAGRRTFICNALALGIPAQVVMKWTG HSDYKAMKPYIDIADDIKANAMNKFNQL" misc_feature 3574..3585 /label=integration site /note="integration site" CDS complement(3857..4714) /label=AmpR /note="beta-lactamase" CDS 5202..5936 /codon_start=1 /product="ErmG" /label=ErmG /protein_id="ARI71344.1" /translation="MNKVNIKDSQNFITSKYHIEKIMNCISLDEKDNIFEIGAGKGHFT AGLVKRCNFVTAIEIDSKLCEVTRNKLLNYPNYQIVNDDILKFTFPSHNPYKIFGSIPY NISTNIIRKIVFESSATISYLIVEYGFAKMLLDTNRSLALLLMAEVDISILAKIPRYYF HPKPKVDSTLIVLKRKPAKMAFKERKKYETFVMKWVNKEYEKLFTKNQFNKALKHARIY DINNISFEQFVSLFNSYKIFNG"
This page is informational only.