pWW102B vector (V002112)

LOCUS       40924_46693        7212 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pWW102B, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7212)
  AUTHORS   Wang W, Attia AS, Liu L, Rosche T, Wagner NJ, Hansen EJ.
  TITLE     Development of a shuttle vector for Moraxella catarrhalis
  JOURNAL   Plasmid 55 (1), 50-57 (2006)
  PUBMED    16188314
REFERENCE   2  (bases 1 to 7212)
  AUTHORS   Wang W, Attia AS, Liu L, Rosche T, Wagner NJ, Hansen EJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-SEP-2004) Microbiology, University of Texas 
            Southwestern Medical Center, 5323 Harry Hines Boulevard, Dallas, TX 
            75390, USA
REFERENCE   3  (bases 1 to 7212)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7212)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; 
            date: "2006"; volume: "55"; issue: "1"; pages: "50-57"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (24-SEP-2004) Microbiology, University of Texas Southwestern Medical
            Center, 5323 Harry Hines Boulevard, Dallas, TX 75390, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7212
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(588..1133)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(6515..7171)
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(join(7172..7212,1..62))
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"