pWormgate2 vector (V002126)

LOCUS       40924_46603       13089 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pWormgate2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13089)
  AUTHORS   Johnson NM, Behm CA, Trowell SC.
  TITLE     Heritable and inducible gene knockdown in C. elegans using Wormgate 
            and the ORFeome
  JOURNAL   Gene 359, 26-34 (2005)
  PUBMED    15994029
REFERENCE   2  (bases 1 to 13089)
  AUTHORS   Johnson NM, Behm CA, Trowell SC.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2004) CSIRO Entomology, Clunies Ross Street, 
            Canberra, ACT 2601, Australia
REFERENCE   3  (bases 1 to 13089)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 13089)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Gene 359, 
            26-34 (2005)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (18-FEB-2004) CSIRO Entomology, Clunies Ross Street, Canberra, ACT 
            2601, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13089
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          7666..8222
                     /strain="N2"
                     /mol_type="other DNA"
                     /db_xref="taxon:6239"
                     /organism="Caenorhabditis elegans"
     source          9837..10603
                     /strain="N2"
                     /mol_type="other DNA"
                     /db_xref="taxon:6239"
                     /organism="Caenorhabditis elegans"
     promoter        26..44
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     CDS             complement(join(1315..1421,1909..2289,2360..2471,
                     3540..3599))
                     /codon_start=1
                     /product="UNC-119"
                     /label=UNC-119
                     /protein_id="AAT12434.1"
                     /translation="MKAEQQQQSIAPGSATFPSQMPRPPPVTEQAITTEAELLAKNQIT
                     PNDVLALPGITQGFLCSPSANVYNIEFTKFQIRDLDTEHVLFEIAKPENETEENLQAQA
                     ESARYVRYRFAPNFLKLKTVGATVEFKVGDVPITHFRMIERHFFKDRLLKCFDFEFGFC
                     MPNSRNNCEHIYEFPQLSQQLMDDMINNPNETRSDSFYFVENKLVMHNKADYSYDA"
     CDS             3828..3839
                     /label=WELQut site
                     /note="WELQut protease recognition and cleavage site"
     promoter        5819..6218
                     /label=hsp16-2
                     /note="C. elegans heat shock protein Hsp-16.2 promoter"
     protein_bind    6231..6355
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             complement(6787..7089)
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(7529..7653)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     protein_bind    8263..8387
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             complement(8722..9024)
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(9561..9685)
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     regulatory      9837..10603
                     /label=unc-54 myosin heavy chain gene
                     /note="unc-54 myosin heavy chain gene"
                     /regulatory_class="terminator"
     promoter        10968..11072
                     /label=AmpR promoter
     CDS             11073..11930
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      12104..12692
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    12980..13001
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        13016..13046
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    13054..13070
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."