Basic Vector Information
- Vector Name:
- pWM91
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8261 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Okamoto S, Niki H.
- Promoter:
- sacB
pWM91 vector Map
pWM91 vector Sequence
LOCUS 40924_46593 8261 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pWM91 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8261) AUTHORS Okamoto S, Niki H. TITLE cloning vector pWM91 sequence JOURNAL Unpublished REFERENCE 2 (bases 1 to 8261) AUTHORS Okamoto S, Niki H. TITLE Direct Submission JOURNAL Submitted (01-APR-2016) Contact:Sho Okamoto National Institute of Genetics, Microbial Genetics Laboratory, Genetics Strains Research Center; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL :https://www.nig.ac.jp/labs/MicroGen/ REFERENCE 3 (bases 1 to 8261) TITLE Direct Submission REFERENCE 4 (bases 1 to 8261) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-APR-2016) Contact:Sho Okamoto National Institute of Genetics, Microbial Genetics Laboratory, Genetics Strains Research Center; 1111 Yata, Mishima, Shizuoka 411-8540, Japan URL :https://www.nig.ac.jp/labs/MicroGen/" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8261 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(59..415) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" primer_bind 746..762 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 772..790 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(799..906) /label=MCS /note="pBluescript multiple cloning site" promoter complement(919..937) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(958..974) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(982..998) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1006..1036) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1051..1072) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." oriT 1778..1887 /label=oriT /note="incP origin of transfer" terminator complement(2113..2156) /label=bacterial terminator /note="putative bacterial transcription terminator" oriT 2208..2317 /label=incP origin of transfer /note="incP origin of transfer" terminator 2565..2624 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." rep_origin complement(2819..3407) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 4444..4889 /label=sacB promoter /note="sacB promoter and control region" CDS 4890..6308 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVSEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" CDS complement(7199..8056) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(8057..8161) /label=AmpR promoter
This page is informational only.