Basic Vector Information
- Vector Name:
- pWLG30
- Antibiotic Resistance:
- Ampicillin
- Length:
- 12689 bp
- Type:
- Expression shuttle vector
- Replication origin:
- ori
- Source/Author:
- Gardner WL, Whitman WB.
pWLG30 vector Map
pWLG30 vector Sequence
LOCUS 40924_46588 12689 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression shuttle vector pWLG30, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12689) AUTHORS Gardner WL, Whitman WB. TITLE Expression vectors for Methanococcus maripaludis: overexpression of acetohydroxyacid synthase and beta-galactosidase JOURNAL Genetics 152 (4), 1439-1447 (1999) PUBMED 10430574 REFERENCE 2 (bases 1 to 12689) AUTHORS Gardner WL, Whitman WB. TITLE Direct Submission JOURNAL Submitted (11-MAR-1999) Microbiology, University of Georgia, Biological Sciences Building, Athens, GA 30602, USA REFERENCE 3 (bases 1 to 12689) TITLE Direct Submission REFERENCE 4 (bases 1 to 12689) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genetics"; date: "1999"; volume: "152"; issue: "4"; pages: "1439-1447" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-MAR-1999) Microbiology, University of Georgia, Biological Sciences Building, Athens, GA 30602, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..12689 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 61..69 /note="PhmvA BoxA; Methanococcus voltae histone promoter Box A" /regulatory_class="promoter" regulatory 92..95 /note="PhmvA BoxB; Methanococcus voltae histone promoter Box B" /regulatory_class="promoter" regulatory 153..158 /regulatory_class="ribosome_binding_site" misc_feature 160..205 /label=polylinker /note="polylinker" regulatory 464..471 /note="Pmcr Box A; promoter for Methanococcus voltae methyl coenzyme M reductase" /regulatory_class="promoter" CDS 988..1587 /codon_start=1 /gene="pac" /product="puromycin transacetylase" /label=pac /note="from Streptomyces alboniger" /protein_id="AAF01148.1" /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER VTRAARTLPHARRARHRQGVGRATRRRGGGLDHAGERRSGGGVRRDRNAHGRVERFPAG RAATDGRPPGAAPAQGARVVPGHRRRLARPPGQGSGQRRRAPRSGGGRARRGARLPGDL RAPQPPFYERLGFTVTADVECPKDRATWCMTRKPGA" gene 988..1587 /gene="pac" /label=pac regulatory 1887..1912 /note="terminator for Methanococcus voltae methyl coenzyme m reductase" /regulatory_class="terminator" promoter 2266..2370 /label=AmpR promoter CDS 2371..3228 /label=AmpR /note="beta-lactamase" rep_origin 3402..3990 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 4278..4299 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 4314..4344 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 4352..4368 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 4376..4392 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 6816..7188 /label=ORFLESS2 /note="ORFLESS2" misc_feature 7948..8733 /label=ORFLESS1 /note="ORFLESS1"
This page is informational only.