pWLG14 vector (V002130)

LOCUS       40924_46583        4404 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Integrative expression vector pWLG14, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4404)
  AUTHORS   Gardner WL, Whitman WB.
  TITLE     Expression vectors for Methanococcus maripaludis: overexpression of 
            acetohydroxyacid synthase and beta-galactosidase
  JOURNAL   Genetics 152 (4), 1439-1447 (1999)
  PUBMED    10430574
REFERENCE   2  (bases 1 to 4404)
  AUTHORS   Gardner WL, Whitman WB.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-MAR-1999) Microbiology, University of Georgia, 
            Biological Sciences Building, Athens, GA 30602, USA
REFERENCE   3  (bases 1 to 4404)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4404)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Genetics"; 
            date: "1999"; volume: "152"; issue: "4"; pages: "1439-1447"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (11-MAR-1999) Microbiology, University of Georgia, Biological 
            Sciences Building, Athens, GA 30602, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4404
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      61..69
                     /note="PhmvA BoxA; Methanococcus voltae histone promoter
                     Box A"
                     /regulatory_class="promoter"
     regulatory      92..95
                     /note="PhmvA BoxB; Methanococcus voltae histone promoter
                     Box B"
                     /regulatory_class="promoter"
     regulatory      153..158
                     /regulatory_class="ribosome_binding_site"
     misc_feature    160..205
                     /label=polylinker
                     /note="polylinker"
     regulatory      464..471
                     /note="Pmcr Box A; promoter for Methanococcus voltae methyl
                     coenzyme M reductase"
                     /regulatory_class="promoter"
     CDS             988..1587
                     /codon_start=1
                     /gene="pac"
                     /product="puromycin transacetylase"
                     /label=pac
                     /note="from Streptomyces alboniger"
                     /protein_id="AAF01146.1"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTRAARTLPHARRARHRQGVGRATRRRGGGLDHAGERRSGGGVRRDRNAHGRVERFPAG
                     RAATDGRPPGAAPAQGARVVPGHRRRLARPPGQGSGQRRRAPRSGGGRARRGARLPGDL
                     RAPQPPFYERLGFTVTADVECPKDRATWCMTRKPGA"
     gene            988..1587
                     /gene="pac"
                     /label=pac
     regulatory      1887..1912
                     /note="terminator for Methanococcus voltae methyl coenzyme
                     m reductase"
                     /regulatory_class="terminator"
     promoter        2266..2370
                     /label=AmpR promoter
     CDS             2371..3228
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      3402..3990
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    4278..4299
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4314..4344
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    4352..4368
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     4376..4392
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"