Basic Vector Information
- Vector Name:
- pWLG14
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4404 bp
- Type:
- Integrative expression vector
- Replication origin:
- ori
- Source/Author:
- Gardner WL, Whitman WB.
pWLG14 vector Map
pWLG14 vector Sequence
LOCUS 40924_46583 4404 bp DNA circular SYN 18-DEC-2018
DEFINITION Integrative expression vector pWLG14, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4404)
AUTHORS Gardner WL, Whitman WB.
TITLE Expression vectors for Methanococcus maripaludis: overexpression of
acetohydroxyacid synthase and beta-galactosidase
JOURNAL Genetics 152 (4), 1439-1447 (1999)
PUBMED 10430574
REFERENCE 2 (bases 1 to 4404)
AUTHORS Gardner WL, Whitman WB.
TITLE Direct Submission
JOURNAL Submitted (11-MAR-1999) Microbiology, University of Georgia,
Biological Sciences Building, Athens, GA 30602, USA
REFERENCE 3 (bases 1 to 4404)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4404)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genetics";
date: "1999"; volume: "152"; issue: "4"; pages: "1439-1447"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-MAR-1999) Microbiology, University of Georgia, Biological
Sciences Building, Athens, GA 30602, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4404
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 61..69
/note="PhmvA BoxA; Methanococcus voltae histone promoter
Box A"
/regulatory_class="promoter"
regulatory 92..95
/note="PhmvA BoxB; Methanococcus voltae histone promoter
Box B"
/regulatory_class="promoter"
regulatory 153..158
/regulatory_class="ribosome_binding_site"
misc_feature 160..205
/label=polylinker
/note="polylinker"
regulatory 464..471
/note="Pmcr Box A; promoter for Methanococcus voltae methyl
coenzyme M reductase"
/regulatory_class="promoter"
CDS 988..1587
/codon_start=1
/gene="pac"
/product="puromycin transacetylase"
/label=pac
/note="from Streptomyces alboniger"
/protein_id="AAF01146.1"
/translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
VTRAARTLPHARRARHRQGVGRATRRRGGGLDHAGERRSGGGVRRDRNAHGRVERFPAG
RAATDGRPPGAAPAQGARVVPGHRRRLARPPGQGSGQRRRAPRSGGGRARRGARLPGDL
RAPQPPFYERLGFTVTADVECPKDRATWCMTRKPGA"
gene 988..1587
/gene="pac"
/label=pac
regulatory 1887..1912
/note="terminator for Methanococcus voltae methyl coenzyme
m reductase"
/regulatory_class="terminator"
promoter 2266..2370
/label=AmpR promoter
CDS 2371..3228
/label=AmpR
/note="beta-lactamase"
rep_origin 3402..3990
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 4278..4299
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 4314..4344
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 4352..4368
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 4376..4392
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
This page is informational only.