Basic Vector Information
pSC101 ori is a low-copy replication origin that requires the Rep101 protein, which is a temperature-sensitive protein. When bacteria containing a plasmid with this ori is cultured at 37℃, the plasmid will be lost.
- Vector Name:
- pWKS130
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6811 bp
- Type:
- Expression vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Wang RF, Kushner SR.
- Copy Number:
- Low Copy
- Promoter:
- T3
- Growth Temperature:
- 30℃
pWKS130 vector Map
pWKS130 vector Sequence
LOCUS 40924_46568 6811 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pWKS130, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6811)
AUTHORS Wang RF, Kushner SR.
TITLE Construction of versatile low-copy-number vectors for cloning,
sequencing and gene expression in Escherichia coli
JOURNAL Gene 100, 195-199 (1991)
PUBMED 2055470
REFERENCE 2 (bases 1 to 6811)
AUTHORS Obrist MW, Miller VL.
TITLE Low copy expression vectors for use in Yersinia sp. and related
organisms
JOURNAL Plasmid 68 (1), 33-42 (2012)
PUBMED 22445322
REFERENCE 3 (bases 1 to 6811)
AUTHORS Obrist MW, Miller VL.
TITLE Direct Submission
JOURNAL Submitted (14-DEC-2011) Microbiology and Immunology, University of
North Carolina at Chapel Hill, 116 Manning Drive, 505 Mary Ellen
Jones, CB# 7290, Chapel Hill, NC 27599, USA
REFERENCE 4 (bases 1 to 6811)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 6811)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene 100,
195-199 (1991)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid";
date: "2012"; volume: "68"; issue: "1"; pages: "33-42"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(14-DEC-2011) Microbiology and Immunology, University of North
Carolina at Chapel Hill, 116 Manning Drive, 505 Mary Ellen Jones,
CB# 7290, Chapel Hill, NC 27599, USA"
COMMENT SGRef: number: 4; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: DNASTAR Lasergene SeqMan Pro v. 7.2.1 (1) Intel
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..6811
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 240..261
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 276..306
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 314..330
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 338..354
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 375..393
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
misc_feature complement(406..513)
/label=MCS
/note="pBluescript multiple cloning site"
promoter complement(522..540)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(550..566)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 708..1136
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
CDS complement(2454..3266)
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
CDS complement(4606..5553)
/codon_start=1
/label=Rep101
/note="RepA protein needed for replication with the pSC101
origin"
/translation="MSELVVFKANELAISRYDLTEHETKLILCCVALLNPTIENPTRKE
RTVSFTYNQYAQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS
SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI
EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV
ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF
LSDMQSKYDLNGSFSWLTQKQRTTLENILAKYGRI"
rep_origin complement(5601..5823)
/direction=LEFT
/label=pSC101 ori
/note="low-copy replication origin that requires the Rep101
protein"
This page is informational only.