Basic Vector Information
- Vector Name:
- pWKS130
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6811 bp
- Type:
- Expression vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Wang RF, Kushner SR.
- Promoter:
- T3
pWKS130 vector Map
pWKS130 vector Sequence
LOCUS 40924_46568 6811 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pWKS130, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6811) AUTHORS Wang RF, Kushner SR. TITLE Construction of versatile low-copy-number vectors for cloning, sequencing and gene expression in Escherichia coli JOURNAL Gene 100, 195-199 (1991) PUBMED 2055470 REFERENCE 2 (bases 1 to 6811) AUTHORS Obrist MW, Miller VL. TITLE Low copy expression vectors for use in Yersinia sp. and related organisms JOURNAL Plasmid 68 (1), 33-42 (2012) PUBMED 22445322 REFERENCE 3 (bases 1 to 6811) AUTHORS Obrist MW, Miller VL. TITLE Direct Submission JOURNAL Submitted (14-DEC-2011) Microbiology and Immunology, University of North Carolina at Chapel Hill, 116 Manning Drive, 505 Mary Ellen Jones, CB# 7290, Chapel Hill, NC 27599, USA REFERENCE 4 (bases 1 to 6811) TITLE Direct Submission REFERENCE 5 (bases 1 to 6811) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene 100, 195-199 (1991)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid"; date: "2012"; volume: "68"; issue: "1"; pages: "33-42" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (14-DEC-2011) Microbiology and Immunology, University of North Carolina at Chapel Hill, 116 Manning Drive, 505 Mary Ellen Jones, CB# 7290, Chapel Hill, NC 27599, USA" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: DNASTAR Lasergene SeqMan Pro v. 7.2.1 (1) Intel Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6811 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 240..261 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 276..306 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 314..330 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 338..354 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 375..393 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" misc_feature complement(406..513) /label=MCS /note="pBluescript multiple cloning site" promoter complement(522..540) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(550..566) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 708..1136 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(2454..3266) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" CDS complement(4606..5553) /codon_start=1 /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin" /translation="MSELVVFKANELAISRYDLTEHETKLILCCVALLNPTIENPTRKE RTVSFTYNQYAQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF LSDMQSKYDLNGSFSWLTQKQRTTLENILAKYGRI" rep_origin complement(5601..5823) /direction=LEFT /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein"
This page is informational only.