Basic Vector Information
- Vector Name:
- pWH1274
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6372 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wang Y, Chen Y, Zhou Q, Huang S, Ning K, Xu J, Kalin RM, Rolfe S, Huang WE.
- Promoter:
- tet
pWH1274 vector Vector Map
pWH1274 vector Sequence
LOCUS 40924_46548 6372 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pWH1274, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6372) AUTHORS Wang Y, Chen Y, Zhou Q, Huang S, Ning K, Xu J, Kalin RM, Rolfe S, Huang WE. TITLE A culture-independent approach to unravel uncultured bacteria and functional genes in a complex microbial community JOURNAL PLoS ONE 7 (10), E47530 (2012) PUBMED 23082176 REFERENCE 2 (bases 1 to 6372) AUTHORS Wang Y, Huang W. TITLE Development of a toolbox for the dissection of naphthalene degradation genes from unculturable microorganisms in complex environment JOURNAL Unpublished REFERENCE 3 (bases 1 to 6372) AUTHORS Wang Y. TITLE Direct Submission JOURNAL Submitted (20-JUL-2011) Kroto Research Institute, University of Sheffield, Broad Lane, Sheffield, South Yorkshire S3 7HQ, United Kingdom REFERENCE 4 (bases 1 to 6372) TITLE Direct Submission REFERENCE 5 (bases 1 to 6372) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "10"; pages: "E47530" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (20-JUL-2011) Kroto Research Institute, University of Sheffield, Broad Lane, Sheffield, South Yorkshire S3 7HQ, United Kingdom" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..6372 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 10..38 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 86..1273 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" misc_feature 4219..4359 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(4545..5133) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5307..6164) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(6165..6269) /label=AmpR promoter
This page is informational only.