Basic Vector Information
- Vector Name:
- pWFRT-tel
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5969 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Barrett AR, Kang Y, Inamasu KS, Son MS, Vukovich JM, Hoang TT.
pWFRT-tel vector Vector Map
pWFRT-tel vector Sequence
LOCUS 40924_46543 5969 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pWFRT-tel, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5969) AUTHORS Barrett AR, Kang Y, Inamasu KS, Son MS, Vukovich JM, Hoang TT. TITLE Genetic tools for allelic replacement in Burkholderia species JOURNAL Appl. Environ. Microbiol. 74 (14), 4498-4508 (2008) PUBMED 18502918 REFERENCE 2 (bases 1 to 5969) AUTHORS Barrett AR, Kang Y, Vukovich JM, Son MS, Hoang TT. TITLE Direct Submission JOURNAL Submitted (04-DEC-2007) Microbiology, University of Hawaii at Manoa, 2538 McCarthy Mall Snyder Hall Rm. 310, Honolulu, HI 96822, USA REFERENCE 3 (bases 1 to 5969) TITLE Direct Submission REFERENCE 4 (bases 1 to 5969) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2008"; volume: "74"; issue: "14"; pages: "4498-4508" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-DEC-2007) Microbiology, University of Hawaii at Manoa, 2538 McCarthy Mall Snyder Hall Rm. 310, Honolulu, HI 96822, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5969 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 96..200 /label=AmpR promoter CDS 201..1058 /label=AmpR /note="beta-lactamase" rep_origin 1232..1820 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2108..2129 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2144..2174 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2182..2198 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2206..2222 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 2289..2356 /label=Flip recognition target /note="Flip recognition target" protein_bind complement(2306..2353) /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." regulatory 2393..2434 /regulatory_class="promoter" RBS 2445..2467 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 2474..3247 /codon_start=1 /gene="kilA" /product="KilA" /label=kilA /note="confers tellurite resistance" /protein_id="ABY57996.1" /translation="MEEQSVNMARLKGEVLPALFASPATIGEYGAGIDGADSLNELSNL MEHGAVAALADKISQIVAKLADADPRKIAEKPTWFEKMLGREVERQVRYQVARKTLDQL LDEAEGVAQRVRDTLRALDDMLNTHEAEVDRLRAYIQAGREFLDENPEAGAAKAGVIEF DKPRERFARKLANLATLMASHEMSVTQMKLTRAQAVDMLDRFSETASVLVPVWRQHTLA LITTKNMNPAMVAEAAKAHQALMRSLSQSLEGINQ" gene 2474..3247 /gene="kilA" /label=kilA CDS 3265..4401 /codon_start=1 /gene="telA" /product="TelA" /label=telA /note="confers tellurite resistance" /protein_id="ABY57997.1" /translation="MNALKTTHDAKAPIVAFDMTPATLRELGLQESDVPEVHAVAQRIE VGSPQTVAEFGRDVAEHTSRYADSLLDQVRNSDLDEAGEKLTQVVAKARSLNVGPLSDN RSRLPLIGPLIDRFRVRSTGFMARFDTTREQIEHLVSEVQTTQQGIAQRNASLDEMFAA VREEHRLLGVHIAAGKVRLAELREQAEGLRGNVGNDPGRVQELADLDAMVANLDKRIGD LIALQHSAMQSLPTIRMIQANNQMLVDKFHTIREITVPAWKRQFMLALSLNEQKNAVEL ATAIDDTTNDLMKRNAALLHRTSVETAKENQRLVIDVDTLKQVQTTLIKTVEDVIRIQQ EGVQKRKDAEKQIAAMRGDLQAKLTRQPVRELAQQESV" gene 3265..4401 /gene="telA" /label=telA CDS 4398..5351 /codon_start=1 /gene="telB" /product="TelB" /label=telB /note="confers tellurite resistance" /protein_id="ABY57998.1" /translation="MNATNTDVFAQVGGLEARGAKMKKRGTRFLIAALAVLAIAGIGAV TGWAISPSATPGSIDVPQVLASTFSDQVPGSEGGGLGGGLPFTSAVGAFTDFMAGPAIF TLGILGIVVAGAVLVFGGEFCGFVRSVCMMVIAVSMIFVSSNLVKGILGGDHDAGPAEP SPRARFMAAVEAKDFARVQELIEARGAKSAADYVLAQLAVAEGLDRKPGARVVVGKAAG SMAMPPAALGFTPRGEAAYAIERSAYGEPRSSIAKQYQQEWNRKAATWWAMAGVAGIIG AILAAAATGFVGLAVSIRNRVKRVRDLLVMEPGAEP" gene 4398..5351 /gene="telB" /label=telB terminator complement(5369..5400) /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" protein_bind complement(5461..5508) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." primer_bind complement(5575..5591) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.