Basic Vector Information
- Vector Name:
- pWB100
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4073 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Dennehy M, Bourn W, Steele D, Williamson AL.
pWB100 vector Map
pWB100 vector Sequence
LOCUS 40924_46193 4073 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pWB100, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4073) AUTHORS Dennehy M, Bourn W, Steele D, Williamson AL. TITLE Evaluation of recombinant BCG expressing rotavirus VP6 as an anti-rotavirus vaccine JOURNAL Vaccine 25 (18), 3646-3657 (2007) PUBMED 17339069 REFERENCE 2 (bases 1 to 4073) AUTHORS Bourn W. TITLE Direct Submission JOURNAL Submitted (27-AUG-2005) Medical Virology, University of Cape Town, Anzio Road, Observatory, Cape Town 7925, South Africa REFERENCE 3 (bases 1 to 4073) TITLE Direct Submission REFERENCE 4 (bases 1 to 4073) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Vaccine"; date: "2007"; volume: "25"; issue: "18"; pages: "3646-3657" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-AUG-2005) Medical Virology, University of Cape Town, Anzio Road, Observatory, Cape Town 7925, South Africa" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4073 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 120..932 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPHAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHNLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1267..1855 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" rep_origin 2014..3909 /label=mycobacterial origin of replication, OriM /note="mycobacterial origin of replication, OriM" terminator 3991..4037 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.