pVZ-CAM.fa vector (V002219)

LOCUS       40924_46143        5080 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pVZ-CAM.fa, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5080)
  AUTHORS   Fraga D, Keenan E, Hendel E, Nair A, Schofield W.
  TITLE     The particle inflow gun can be used to co-transform Paramecium using
            Tungsten particles
  JOURNAL   J. Eukaryot. Microbiol. 53 (1), 16-19 (2006)
  PUBMED    16441576
REFERENCE   2  (bases 1 to 5080)
  AUTHORS   Fraga D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) Biology, College of Wooster, 931 College 
            Mall, Wooster, OH 44691, USA
REFERENCE   3  (bases 1 to 5080)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5080)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. 
            Eukaryot. Microbiol."; date: "2006"; volume: "53"; issue: "1"; 
            pages: "16-19"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (05-MAY-2004) Biology, College of Wooster, 931 College Mall, 
            Wooster, OH 44691, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5080
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          930..2779
                     /mol_type="other DNA"
                     /db_xref="taxon:5888"
                     /organism="Paramecium tetraurelia"
     rep_origin      complement(237..692)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     837..853
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        860..878
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             complement(1557..2006)
                     /codon_start=1
                     /product="calmodulin"
                     /label=calmodulin
                     /protein_id="AAT38517.1"
                     /translation="MAE*LTEE*IAEFKEAFALFDKDGDGTITTKELGTVMRSLG*NPT
                     EAELQDMINEVDADGNGTIDFPEFLSLMARKMKE*DSEEELIEAFKVFDRDGNGLISAA
                     ELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVSK"
     promoter        complement(2820..2838)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(2859..2875)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(2883..2899)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2907..2937)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(2952..2973)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(3261..3849)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4023..4880)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(4881..4985)
                     /label=AmpR promoter