pVR37 vector (V002226)

Download GeneBank File(.gb)

LOCUS       40924_46108       12588 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Promoter probe vector pVR37, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12588)
  AUTHORS   Medi VG, Bhat RS, Kuruvinashetti MS.
  TITLE     Promoter-probe vector with synthetic xylanase reporter
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 12588)
  AUTHORS   Medi VG, Bhat RS, Kuruvinashetti MS.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAY-2008) Department of Biotechnology, University of 
            Agricultural Sciences, Dharwad, Karnataka 580 005, India
REFERENCE   3  (bases 1 to 12588)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12588)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (20-MAY-2008) Department of Biotechnology, University of 
            Agricultural Sciences, Dharwad, Karnataka 580 005, India"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12588
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     complement(39..55)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        432..777
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     intron          809..998
                     /label=cat1 intron
                     /note="castor bean catalase intron, modified"
     CDS             993..2816
                     /label=GUSPlus(TM)
                     /note="beta-glucuronidase"
     CDS             2823..2840
                     /label=6xHis
                     /note="6xHis affinity tag"
     terminator      2872..3124
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    3146..3170
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             4470..5096
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             5533..6597
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      6666..6860
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    7204..7344
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(7530..8118)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(8208..8999)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_feature    9424..9448
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     polyA_signal    complement(9526..9700)
                     /label=CaMV poly(A) signal
                     /note="cauliflower mosaic virus polyadenylation signal"
     CDS             complement(9743..10765)
                     /label=HygR
                     /note="aminoglycoside phosphotransferase from E. coli"
     promoter        complement(10833..11510)
                     /label=CaMV 35S promoter (enhanced)
                     /note="cauliflower mosaic virus 35S promoter with a
                     duplicated enhancer region"
     protein_bind    11701..11722
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        11737..11767
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    11775..11791
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     11799..11815
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(11846..12559)
                     /codon_start=1
                     /product="xylanase A"
                     /label=xylanase A
                     /note="derived from Neocallimastix patriciarum"
                     /protein_id="ACE77059.1"
                     /translation="MASNGKKFTVGNGQNQHKGVNDGFSYEIWLDNTGGNGSMTLGSGA
                     TFKAEWNAAVNRGNFLARRGLDFGSQKKATDYDYIGLDYAATYKQTASASGNSRLCVYG
                     WFQNRGLNGVPLVEYYIIEDWVDWVPDAQGKMVTIDGAQYKIFQMDHTGPTINGGSETF
                     KQYFSVRQQKRTSGHITVSDHFKEWAKQGWGIGNLYEVALNAEGWQSSGVADVTLLDVY
                     TTPKGSSPATSAAPR"
     5'UTR           complement(12560..12587)