Basic Vector Information
- Vector Name:
- pVLG6
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6607 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zeigler DR.
- Promoter:
- T3
pVLG6 vector Map
pVLG6 vector Sequence
LOCUS V002235 6607 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002235 VERSION V002235 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6607) AUTHORS Zeigler DR. TITLE Sequence of pVLG6, a shuttle vector for constructing GFP fusions in Bacillus megaterium and other Gram-positive bacteria JOURNAL Unpublished REFERENCE 2 (bases 1 to 6607) AUTHORS Zeigler DR. TITLE Direct Submission JOURNAL Submitted (18-APR-2011) Bacillus Genetic Stock Center, The Ohio State University, 484 W 12th Ave, Columbus, OH 43210, USA REFERENCE 3 (bases 1 to 6607) TITLE Direct Submission REFERENCE 4 (bases 1 to 6607) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-APR-2011) Bacillus Genetic Stock Center, The Ohio State University, 484 W 12th Ave, Columbus, OH 43210, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6607 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 18..34 /label="KS primer" /note="common sequencing primer, one of multiple similar variants" CDS 61..774 /label="GFP" /note="green fluorescent protein" primer_bind complement(792..808) /label="SK primer" /note="common sequencing primer, one of multiple similar variants" CDS 1202..1387 /codon_start=1 /gene="cop" /product="Cop" /label="cop" /note="copy control regulatory protein for Gram-positive replication" /protein_id="AEP13839.1" /translation="MLGGTVMVVDRKEEKKVAVTLRLTTEENEILNRIKEKYNISKSDA TGILIKKYAKEEYGAF" gene 1202..1387 /gene="cop" /label="cop" CDS 1468..2067 /codon_start=1 /gene="repF" /product="RepF" /label="repF" /note="initiation protein for Gram-positive replication" /protein_id="AEP13838.1" /translation="MSENVIKETENKKNSRGRNWTFVLYPESAKAEWLEYLKELHIQFV VSPLHDRDTDTEGRMKKEHYHILVMYEGNKSYEQIKIITEELNATIPQIAGSVKGLVRY MLHMDDPNKFKYQKEDMIVYGGVDVDELLKKTTTDRYKLIKEMIEFIDEQGIVEFKSLM DYAMKFKFDDWFPLLCDNSAYVIQEYIKSNRYKSDR" gene 1468..2067 /gene="repF" /label="repF" promoter complement(2703..2721) /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2728..2744) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" rep_origin complement(2885..3340) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3367..3471 /label="AmpR promoter" CDS 3472..4329 /label="AmpR" /note="beta-lactamase" rep_origin 4503..5091 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5458..6105) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" protein_bind 6443..6464 /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 6479..6509 /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind 6517..6533 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6541..6557 /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" promoter 6578..6596 /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase"
This page is informational only.