Basic Vector Information
- Vector Name:
- pVIK110
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9334 bp
- Type:
- Suicide vector
- Replication origin:
- R6K γ ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pVIK110 vector Vector Map
pVIK110 vector Sequence
LOCUS V002242 9334 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002242 VERSION V002242 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9334) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 9334) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 9334) TITLE Direct Submission REFERENCE 4 (bases 1 to 9334) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9334 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 90..3140 /label="lacZ" /note="beta-galactosidase" CDS 3195..4445 /gene="lacY" /label="Lactose permease" /note="Lactose permease from Escherichia coli (strain K12). Accession#: P02920" CDS 4512..5059 /codon_start=1 /note="unnamed protein product; lacA fragment" /protein_id="SJL88066.1" /translation="LNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVE KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI VTKDIPPNVVAAGVPCRVI" CDS 5415..6206 /label="NeoR/KanR" /note="aminoglycoside phosphotransferase" CDS complement(7766..8134) /label="traJ" /note="oriT-recognizing protein" oriT complement(8167..8276) /direction=LEFT /label="oriT" /note="incP origin of transfer" rep_origin 8920..9276 /label="R6K gamma ori" /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication"
This page is informational only.