Basic Vector Information
- Vector Name:
- pVIK107
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9335 bp
- Type:
- Suicide vector
- Replication origin:
- R6K γ ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pVIK107 vector Map
pVIK107 vector Sequence
LOCUS V002243 9335 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V002243
VERSION V002243
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 9335)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 9335)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 9335)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9335)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9335
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 88..3141
/label="lacZ"
/note="beta-galactosidase"
CDS 3196..4446
/gene="lacY"
/label="Lactose permease"
/note="Lactose permease from Escherichia coli (strain K12).
Accession#: P02920"
CDS 4513..5060
/codon_start=1
/note="unnamed protein product; lacA fragment"
/protein_id="SJL88062.1"
/translation="LNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVE
KRESLIKEMFATVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLI
APNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSI
VTKDIPPNVVAAGVPCRVI"
CDS 5416..6207
/label="NeoR/KanR"
/note="aminoglycoside phosphotransferase"
CDS complement(7767..8135)
/label="traJ"
/note="oriT-recognizing protein"
oriT complement(8168..8277)
/direction=LEFT
/label="oriT"
/note="incP origin of transfer"
rep_origin 8921..9277
/label="R6K gamma ori"
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
This page is informational only.