Basic Vector Information
- Vector Name:
- pVCC
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5155 bp
- Type:
- Transformation and cloning vector
- Replication origin:
- ori
- Source/Author:
- Vannini A, Agriesti F, Mosca F, Roncarati D, Scarlato V, Danielli A.
pVCC vector Vector Map
pVCC vector Sequence
LOCUS V002250 5155 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002250 VERSION V002250 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5155) AUTHORS Vannini A, Agriesti F, Mosca F, Roncarati D, Scarlato V, Danielli A. TITLE A convenient and robust in vivo reporter system to monitor gene expression in the human pathogen Helicobacter pylori JOURNAL Appl. Environ. Microbiol. 78 (18), 6524-6533 (2012) PUBMED 22773640 REFERENCE 2 (bases 1 to 5155) AUTHORS Danielli A. TITLE Direct Submission JOURNAL Submitted (01-SEP-2010) Department of Biology, University of Bologna, via Selmi, 3, Bologna, BO 40126, Italy REFERENCE 3 (bases 1 to 5155) TITLE Direct Submission REFERENCE 4 (bases 1 to 5155) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2012"; volume: "78"; issue: "18"; pages: "6524-6533" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-SEP-2010) Department of Biology, University of Bologna, via Selmi, 3, Bologna, BO 40126, Italy" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5155 /mol_type="other DNA" /organism="synthetic DNA construct" misc_recomb 1..564 /note="flanking region for double homologous recombination in Helicobacter pylori G27 vac::aphA-3/luxCDABE acceptor strain" CDS 27..542 /codon_start=1 /gene="cysS" /product="CysS" /label="cysS" /protein_id="ADZ38982.1" /translation="YLLGVHYRSVLNFNEEDLLVSKKRLDKIYRLKQRVLGTLGGINPN FKKEILECMQDDLNVSKALSVLESMLSSTNEKLDQNPKNKALKGEILANLKFIEELLGI GFKDPSAYFQLGVSESEKQEIENKIEERKRAKEQKNFLKADSIREELLKQKIALMDTPQ GTIWEKFF" gene 27..542 /gene="cysS" /label="cysS" /note="Helicobacter pylori cysS cistron 5' end" CDS complement(683..1303) /note="Chloramphenicol acetyltransferase from Campylobacter coli. Accession#: P22782" /label="Chloramphenicol acetyltransferase" misc_feature 1407..1448 /note="MCS; multiple cloning site; unique BamHI, KpnI, SacI, and SnaBI cloning sites" gene 1440..2467 /gene="luxC" /label="luxC" /note="Photorhabdus luminescens luxC cistron 5' end" regulatory 1440..1445 /gene="luxC" /regulatory_class="ribosome_binding_site" misc_recomb 1451..2467 /note="flanking region for double homologous recombination in Helicobacter pylori G27 vac::aphA-3/luxCDABE acceptor strain" CDS 1451..2467 /codon_start=1 /gene="luxC" /product="LuxC" /label="luxC" /protein_id="ADZ38983.1" /translation="MTKKISFIINGQVEIFPESDDLVQSINFGDNSVYLPILNDSHVKN IIDCNGNNELRLHNIVNFLYTVGQRWKNEEYSRRRTYIRDLKKYMGYSEEMAKLEANWI SMILCSKGGLYDVVENELGSRHIMDEWLPQDESYVRAFPKGKSVHLLAGNVPLSGIMSI LRAILTKNQCIIKTSSTDPFTANALALSFIDVDPNHPITRSLSVIYWPHQGDTSLAKEI MRHADVIVAWGGPDAINWAVEHAPSYADVIKFGSKKSLCIIDNPVDLTSAATGAAHDVC FYDQRACFSAQNIYYMGNHYEEFKLALIEKLNLYAHILPNAKKDFDEKAAYSLVQKES" promoter complement(2476..2494) /label="SP6 promoter" /note="promoter for bacteriophage SP6 RNA polymerase" primer_bind complement(2512..2528) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2536..2552) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2560..2590) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(2605..2626) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2914..3502) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3676..4533) /label="AmpR" /note="beta-lactamase" promoter complement(4534..4638) /label="AmpR promoter" primer_bind 5112..5128 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 5135..5153 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.