Basic Vector Information
- Vector Name:
- pVALIUM1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6742 bp
- Type:
- RNAi cloning vector
- Replication origin:
- ori
- Source/Author:
- Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
- Promoter:
- hsp70
pVALIUM1 vector Map
pVALIUM1 vector Sequence
LOCUS 40924_45873 6742 bp DNA circular SYN 18-DEC-2018
DEFINITION RNAi cloning vector pVALIUM1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6742)
AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
TITLE Vectors for transgenic flies
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6742)
AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue
Louis Pasteur, Boston, MA 02115, USA
REFERENCE 3 (bases 1 to 6742)
AUTHORS Hu Y, Perkins LA.
TITLE Direct Submission
JOURNAL Submitted (20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue
Louis Pasteur, Boston, MA 02115, USA
REFERENCE 4 (bases 1 to 6742)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 6742)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue Louis
Pasteur, Boston, MA 02115, USA"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue Louis
Pasteur, Boston, MA 02115, USA"
COMMENT SGRef: number: 4; type: "Journal Article"
COMMENT On Jun 20, 2012 this sequence version replaced GU931383.1.
FEATURES Location/Qualifiers
source 1..6742
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(6..461)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 603..619
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 626..644
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 664..2543
/label=vermilion
/note="vermilion"
CDS complement(join(834..951,1028..1121,1213..1819,1874..2007,
2068..2228,2302..2327))
/codon_start=1
/product="vermillion"
/label=vermillion
/note="selectable marker"
/protein_id="ADE08345.1"
/translation="MSCPYAGNGNDHDDSAVPLTTEVGKIYGEYLMLDKLLDAQCMLSE
EDKRPVHDEHLFIITHQAYELWFKQIIFEFDSIRDMLDAEVIDETKTLEIVKRLNRVVL
ILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLIENKLGVLTEQRVRYNQKY
SDVFSDEEARNSIRNSEKDPSLLELVQRWLERTPGLEESGFNFWAKFQESVDRFLEAQV
QSAMEEPVEKAKNYRLMDIEKRREVYRSIFDPAVHDALVRRGDRRFSHRALQGAIMITF
YRDEPRFSQPHQLLTLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTL
SDRYKVFLDLFNLSTFLIPREAIPPLDETIRKKLINKSV"
protein_bind 2640..2709
/label=attB
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
protein_bind 2947..2980
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
protein_bind 2993..3087
/label=5X UAS
/note="five tandem copies of the 'ScaI site' 17-mer
CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS)
that efficiently binds yeast Gal4 (Webster et al., 1988;
Pfeiffer et al., 2010)"
misc_recomb 3103..3136
/label=LoxP
/note="LoxP"
protein_bind complement(3103..3136)
/label=loxP
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GCATACAT)."
misc_feature 3143..3252
/label=5XUAS
/note="5XUAS"
protein_bind 3149..3243
/label=5X UAS
/bound_moiety="GAL4"
/note="five tandem copies of the ""ScaI site"" 17-mer
CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS)
that efficiently binds yeast Gal4 (Webster et al., 1988;
Pfeiffer et al., 2010)"
promoter 3267..3505
/label=hsp70 promoter
/note="Drosophila melanogaster hsp70Bb promoter"
misc_feature 3519..3524
/label=multiple cloning site
/note="multiple cloning site"
intron 3547..3620
/note="white intron"
misc_feature 3620..3625
/label=multiple cloning site
/note="multiple cloning site"
intron 3669..3815
/note="ftz intron"
intron 3915..3980
/label=small t intron
/note="SV40 (simian virus 40) small t antigen intron"
CDS 4110..4130
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
polyA_signal 4402..4536
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
promoter complement(4557..4575)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(4596..4612)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4620..4636)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4644..4674)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4689..4710)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4998..5586)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5760..6617)
/label=AmpR
/note="beta-lactamase"
promoter complement(6618..6722)
/label=AmpR promoter
This page is informational only.