Basic Vector Information
- Vector Name:
- pVALIUM1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6742 bp
- Type:
- RNAi cloning vector
- Replication origin:
- ori
- Source/Author:
- Ni J-Q., Liu L-P., Perkins LA, Perrimon N.
- Promoter:
- hsp70
pVALIUM1 vector Vector Map
pVALIUM1 vector Sequence
LOCUS 40924_45873 6742 bp DNA circular SYN 18-DEC-2018 DEFINITION RNAi cloning vector pVALIUM1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6742) AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N. TITLE Vectors for transgenic flies JOURNAL Unpublished REFERENCE 2 (bases 1 to 6742) AUTHORS Ni J-Q., Liu L-P., Perkins LA, Perrimon N. TITLE Direct Submission JOURNAL Submitted (02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA REFERENCE 3 (bases 1 to 6742) AUTHORS Hu Y, Perkins LA. TITLE Direct Submission JOURNAL Submitted (20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA REFERENCE 4 (bases 1 to 6742) TITLE Direct Submission REFERENCE 5 (bases 1 to 6742) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2010) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (20-JUN-2012) Genetics, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT On Jun 20, 2012 this sequence version replaced GU931383.1. FEATURES Location/Qualifiers source 1..6742 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(6..461) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 603..619 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 664..2543 /label=vermilion /note="vermilion" CDS complement(join(834..951,1028..1121,1213..1819,1874..2007, 2068..2228,2302..2327)) /codon_start=1 /product="vermillion" /label=vermillion /note="selectable marker" /protein_id="ADE08345.1" /translation="MSCPYAGNGNDHDDSAVPLTTEVGKIYGEYLMLDKLLDAQCMLSE EDKRPVHDEHLFIITHQAYELWFKQIIFEFDSIRDMLDAEVIDETKTLEIVKRLNRVVL ILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLIENKLGVLTEQRVRYNQKY SDVFSDEEARNSIRNSEKDPSLLELVQRWLERTPGLEESGFNFWAKFQESVDRFLEAQV QSAMEEPVEKAKNYRLMDIEKRREVYRSIFDPAVHDALVRRGDRRFSHRALQGAIMITF YRDEPRFSQPHQLLTLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTL SDRYKVFLDLFNLSTFLIPREAIPPLDETIRKKLINKSV" protein_bind 2640..2709 /label=attB /note="attB site for the phi-C31 integrase (Groth et al., 2000)" protein_bind 2947..2980 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." protein_bind 2993..3087 /label=5X UAS /note="five tandem copies of the 'ScaI site' 17-mer CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) that efficiently binds yeast Gal4 (Webster et al., 1988; Pfeiffer et al., 2010)" misc_recomb 3103..3136 /label=LoxP /note="LoxP" protein_bind complement(3103..3136) /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." misc_feature 3143..3252 /label=5XUAS /note="5XUAS" protein_bind 3149..3243 /label=5X UAS /bound_moiety="GAL4" /note="five tandem copies of the ""ScaI site"" 17-mer CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) that efficiently binds yeast Gal4 (Webster et al., 1988; Pfeiffer et al., 2010)" promoter 3267..3505 /label=hsp70 promoter /note="Drosophila melanogaster hsp70Bb promoter" misc_feature 3519..3524 /label=multiple cloning site /note="multiple cloning site" intron 3547..3620 /note="white intron" misc_feature 3620..3625 /label=multiple cloning site /note="multiple cloning site" intron 3669..3815 /note="ftz intron" intron 3915..3980 /label=small t intron /note="SV40 (simian virus 40) small t antigen intron" CDS 4110..4130 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" polyA_signal 4402..4536 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter complement(4557..4575) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(4596..4612) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4620..4636) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4644..4674) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4689..4710) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4998..5586) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5760..6617) /label=AmpR /note="beta-lactamase" promoter complement(6618..6722) /label=AmpR promoter
This page is informational only.