pVA838 vector (V002258)

LOCUS       V002258                 9065 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002258
VERSION     V002258
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9065)
  AUTHORS   Honeyman AL, Cote CK, Curtiss R III.
  TITLE     Construction of transcriptional and translational lacZ gene reporter
            plasmids for use in Streptococcus mutans
  JOURNAL   J. Microbiol. Methods 49 (2), 163-171 (2002)
   PUBMED   11830302
REFERENCE   2  (bases 1 to 9065)
  AUTHORS   Honeyman AL, Cote CK, Curtiss R III.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2001) Department of Medical Microbiology and
            Immunology, University of South Florida, 12901 Bruce B. Downs Blvd.,
            Tampa, FL 33612, USA
REFERENCE   3  (bases 1 to 9065)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9065)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J.
            Microbiol. Methods"; date: "2002"; volume: "49"; issue: "2"; pages:
            "163-171"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (06-AUG-2001) Department of Medical Microbiology and Immunology,
            University of South Florida, 12901 Bruce B. Downs Blvd., Tampa, FL
            33612, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9065
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             58..1245
                     /label="TcR"
                     /note="tetracycline efflux protein"
     CDS             complement(2285..2941)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(2942..3044)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(3570..4115)
                     /direction=LEFT
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     CDS             6077..6790
                     /codon_start=1
                     /gene="rep"
                     /product="replication protein"
                     /label="rep"
                     /note="required for replication in Gram positive hosts"
                     /protein_id="AAN02503.1"
                     /translation="MKYAYQAELVVNEAMKRYPKGRFLFLTLTIKNISGEKLNKSISEI
                     GRAFNRLMKYKKVDKNVIGYLRATEVTYSTEHENYHPHLHVLLFVKSSYFTGNNTNYIS
                     QEEWTKLWAKAMKLDYTPVVDIRTVKAHKRKNLKSAIIETAKYPVKPFDVDTEDVTLFS
                     EMVKERITEDLTNGLHRKRQIGFGKLFKKIKAELALDDVEEGNLVQTGAEESAESTGRE
                     IVAFWNWDRKNYFVR"
     gene            6077..6790
                     /gene="rep"
                     /label="rep"
     CDS             complement(7418..8152)
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"