Basic Vector Information
- Vector Name:
- pUT3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5769 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kasai Y, Matsuzaki K, Ikeda F, Yoshimitsu Y, Harayama S.
- Promoter:
- T3
pUT3 vector Map
pUT3 vector Sequence
LOCUS 40924_45818 5769 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pUT3 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5769) AUTHORS Kasai Y, Matsuzaki K, Ikeda F, Yoshimitsu Y, Harayama S. TITLE Precise excision of a selectable marker gene in transgenic Pseudococcomyxa strains by the piggyBac transposase JOURNAL Unpublished REFERENCE 2 (bases 1 to 5769) AUTHORS Kasai Y, Harayama S. TITLE Direct Submission JOURNAL Submitted (08-JUN-2017) Contact:Yuki Kasai Chuo University, Research and Development Initiative; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan REFERENCE 3 (bases 1 to 5769) TITLE Direct Submission REFERENCE 4 (bases 1 to 5769) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-JUN-2017) Contact:Yuki Kasai Chuo University, Research and Development Initiative; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5769 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 4..459 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 670..686 /label=KS primer /note="common sequencing primer, one of multiple similar variants" regulatory 694..1341 /gene="EF1a" /note="Includes promoter region of Pseudococcomyxa sp. strain KJ nuclear gene EF1a for elongation factor 1 alpha" /regulatory_class="promoter" gene 694..1341 /gene="EF1a" /label=EF1a regulatory 1336..1345 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" CDS 1342..2847 /codon_start=1 /gene="UMPS" /product="uridine monophosphate synthase" /label=UMPS /protein_id="BAY00744.1" /translation="MATSTPSVATAAELKPKEGPITSQEFEELVLRLHEIEAVKFGNFK LKSGLMSPIYIDLRVIVSYPDVLRRVAEVMWHQVSGAGFDVMCGVPYTALPIATCMSLL HGTPMLMRRKEVKEYGTKKAIEGAFKKGQTCLIVEDLVTSGASVMETVEPLEVEGLKVA DVVVLIDREQGGAARMASNGLRLHSAFTLSFIIKTLQAHGLVSAEVADSVAAFIAANQT FSPSAAAAPTPASAPPAQPKRLPFGERAALCQNAAGRKLLELMARKRTNLAVAADVATV EEMLRIADAAGPHIAVFKTHVDIFDEWDDGIAAQLRHLADKHEFLIFEDRKFADIGNTV VSQYGGGIYKIADWSDITNAHLVPGPGIIDGLRKVGQEKGRGLLLLAEMSSKGALATGA YTEKVAEAAAANQDFVMGFICQSPAKWATSVPPGLVHMTPGVQLASGSDALGQQYNTPA SVIGQGGSDVIIVGRGIIKAADPAAAAAQYREAGWAAYEATLA" gene 1342..2847 /gene="UMPS" /label=UMPS regulatory 2853..3544 /gene="EF1a" /note="Includes terminator region of Pseudococcomyxa sp. strain KJ nuclear gene EF1a for elongation factor 1 alpha" /regulatory_class="terminator" gene 2853..3544 /gene="EF1a" /label=EF1a promoter complement(3581..3599) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(3620..3636) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3644..3660) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3668..3698) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3713..3734) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4022..4610) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4784..5641) /label=AmpR /note="beta-lactamase" promoter complement(5642..5746) /label=AmpR promoter
This page is informational only.