Basic Vector Information
- Vector Name:
- pUT3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5769 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kasai Y, Matsuzaki K, Ikeda F, Yoshimitsu Y, Harayama S.
- Promoter:
- T3
pUT3 vector Map
pUT3 vector Sequence
LOCUS 40924_45818 5769 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pUT3 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5769)
AUTHORS Kasai Y, Matsuzaki K, Ikeda F, Yoshimitsu Y, Harayama S.
TITLE Precise excision of a selectable marker gene in transgenic
Pseudococcomyxa strains by the piggyBac transposase
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5769)
AUTHORS Kasai Y, Harayama S.
TITLE Direct Submission
JOURNAL Submitted (08-JUN-2017) Contact:Yuki Kasai Chuo University, Research
and Development Initiative; 1-13-27 Kasuga, Bunkyo-ku, Tokyo
112-8551, Japan
REFERENCE 3 (bases 1 to 5769)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5769)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(08-JUN-2017) Contact:Yuki Kasai Chuo University, Research and
Development Initiative; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551,
Japan"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5769
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 4..459
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 600..616
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 626..644
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind 670..686
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
regulatory 694..1341
/gene="EF1a"
/note="Includes promoter region of Pseudococcomyxa sp.
strain KJ nuclear gene EF1a for elongation factor 1 alpha"
/regulatory_class="promoter"
gene 694..1341
/gene="EF1a"
/label=EF1a
regulatory 1336..1345
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
CDS 1342..2847
/codon_start=1
/gene="UMPS"
/product="uridine monophosphate synthase"
/label=UMPS
/protein_id="BAY00744.1"
/translation="MATSTPSVATAAELKPKEGPITSQEFEELVLRLHEIEAVKFGNFK
LKSGLMSPIYIDLRVIVSYPDVLRRVAEVMWHQVSGAGFDVMCGVPYTALPIATCMSLL
HGTPMLMRRKEVKEYGTKKAIEGAFKKGQTCLIVEDLVTSGASVMETVEPLEVEGLKVA
DVVVLIDREQGGAARMASNGLRLHSAFTLSFIIKTLQAHGLVSAEVADSVAAFIAANQT
FSPSAAAAPTPASAPPAQPKRLPFGERAALCQNAAGRKLLELMARKRTNLAVAADVATV
EEMLRIADAAGPHIAVFKTHVDIFDEWDDGIAAQLRHLADKHEFLIFEDRKFADIGNTV
VSQYGGGIYKIADWSDITNAHLVPGPGIIDGLRKVGQEKGRGLLLLAEMSSKGALATGA
YTEKVAEAAAANQDFVMGFICQSPAKWATSVPPGLVHMTPGVQLASGSDALGQQYNTPA
SVIGQGGSDVIIVGRGIIKAADPAAAAAQYREAGWAAYEATLA"
gene 1342..2847
/gene="UMPS"
/label=UMPS
regulatory 2853..3544
/gene="EF1a"
/note="Includes terminator region of Pseudococcomyxa sp.
strain KJ nuclear gene EF1a for elongation factor 1 alpha"
/regulatory_class="terminator"
gene 2853..3544
/gene="EF1a"
/label=EF1a
promoter complement(3581..3599)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(3620..3636)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(3644..3660)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3668..3698)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(3713..3734)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4022..4610)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4784..5641)
/label=AmpR
/note="beta-lactamase"
promoter complement(5642..5746)
/label=AmpR promoter
This page is informational only.