pUT2 vector (V002269)

Download GeneBank File(.gb)

LOCUS       40924_45813        6021 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pUT2 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6021)
  AUTHORS   Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.
  TITLE     Construction of self-cloning system in a unicellular green algae, 
            Pseudochoricystis ellipsoidea
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6021)
  AUTHORS   Kasai Y, Oshima K, Ikeda F, Abe J, Yoshimitsu Y, Harayama S.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-DEC-2014) Contact:Yuki Kasai Chuo University, 
            Biological Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan
REFERENCE   3  (bases 1 to 6021)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6021)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (22-DEC-2014) Contact:Yuki Kasai Chuo University, Biological 
            Science; 1-13-27 Kasuga, Bunkyo-ku, Tokyo 112-8551, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6021
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      1..790
                     /note="includes promoter region of Pseudochoricystis
                     ellipsoidea nuclear gene RBCS for ribulose bisphosphate 
                     carboxylase/oxygenase small subunit"
                     /regulatory_class="promoter"
     misc_feature    795..1073
                     /note="include intron 1 of Pseudochoricystis ellipsoidea
                     nuclear gene RBCS for ribulose bisphosphate 
                     carboxylase/oxygenase small subunit"
     CDS             1076..2578
                     /codon_start=1
                     /gene="UMPS"
                     /product="uridine monophosphate synthase"
                     /label=UMPS
                     /protein_id="BAR90702.1"
                     /translation="MATSTPSVATAAELKPKEGPITSQEFEELVLRLHEIEAVKFGNFK
                     LKSGLMSPIYIDLRVIVSYPDVLRRVAEVMWHQVSGAAFDVMCGVPYTALPIATCMSLL
                     HGTPMLMRRKEVKEYGTKKAIEGAFKKGQTCLIVEDLVTSGASVMETVEPLEVEGLKVT
                     DVVVLIDREQGGAARMASNGLRLHSAFTLSFIIKTLQAHGLVSAKVADSVAAFIAANQT
                     FTPSAAAPTPSPAAPAQPKRLPFEERASLCQNAAGRKLLELMARKRTNLAVAADVATVE
                     EMLRIADAAGPHIAVFKTHVDIFDKWDDGIATQLRHLADKHEFLIFEDRKFADIGNTVV
                     SQYGGGIYKIADWSDITNAHLVPGPGIIDGLRKVGQEKGRGLLLLAEMSSKGALATGAY
                     TEKVAEAAAANQDFVMGFICQSPAKWATPVPPGLVHMTPGVQLASGSDALGQQYNTPAS
                     VIGQGGSDVIIVGRGIIKAADPAAAAAQYREAGWAAYEATLA"
     gene            1076..2578
                     /gene="UMPS"
                     /label=UMPS
     regulatory      2594..3111
                     /note="includes terminator region of Pseudochoricystis 
                     ellipsoidea nuclear gene RBCS for ribulose bisphosphate 
                     carboxylase/oxygenase small subunit"
                     /regulatory_class="terminator"
     promoter        complement(3145..3163)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(3184..3200)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(3208..3224)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3232..3262)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3277..3298)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(3586..4174)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4348..5205)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(5206..5310)
                     /label=AmpR promoter
     rep_origin      5337..5792
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     5933..5949
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        5959..5977
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"