pUT-dfrA17 vector (V002272)

LOCUS       40924_45798        5935 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Mini Tn5 transposon vector pUT-dfrA17, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5935)
  AUTHORS   Tsai Y, Chu C, Lee C-H., Liaw S-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2013) Department of Clinical Laboratory Sciences 
            and Medical Biotechnology, College of Medicine, National Taiwan 
            University, No. 1, Chang-Te St., Taipei 100, Taiwan
REFERENCE   2  (bases 1 to 5935)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 5935)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted 
            (24-OCT-2013) Department of Clinical Laboratory Sciences and Medical
            Biotechnology, College of Medicine, National Taiwan University, No. 
            1, Chang-Te St., Taipei 100, Taiwan"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..5935
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(314..1171)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(1172..1276)
                     /label=AmpR promoter
     CDS             complement(1326..2753)
                     /label=Tn5 transposase
                     /note="transposase from the bacterial Tn5 transposon
                     (Reznikoff, 1993)"
     misc_feature    2871..2889
                     /note="Tn5 inside end; IE"
     CDS             3007..3555
                     /codon_start=1
                     /gene="dfrA17"
                     /product="dihydrofolate reductase DfrA17"
                     /label=dfrA17
                     /protein_id="AHG52772.1"
                     /translation="MLWSSNDVTQQGSRPKTKLAIKGVKLKISLISAVSENGVIGSGPD
                     IPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYAVVSKNGISSSNENVLVFPS
                     IENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHVEVEGDIKFPIMPENFNLV
                     FEQFFMSNINYTYQIWKKG"
     gene            3007..3555
                     /gene="dfrA17"
                     /label=dfrA17
     misc_feature    3568..3586
                     /note="Tn5 outside end; OE"
     protein_bind    complement(3598..3614)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     rep_origin      complement(3649..4037)
                     /direction=LEFT
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     CDS             complement(4658..5026)
                     /label=traJ
                     /note="oriT-recognizing protein"
     oriT            complement(5059..5168)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"