Basic Vector Information
- Vector Name:
- pUMRI-13
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5901 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Xie W, Lv X, Yu H.
- Promoter:
- GAL1,10
pUMRI-13 vector Map
pUMRI-13 vector Sequence
LOCUS 40924_45748 5901 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pUMRI-13, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5901)
AUTHORS Xie W, Lv X, Yu H.
TITLE pUMRI plasmids for metabolic pathway assembly
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5901)
AUTHORS Xie W, Lv X, Yu H.
TITLE Direct Submission
JOURNAL Submitted (21-JUL-2014) Department of Chemical and Biological
Engineering, Zhejiang University, Institute of Bioengineering, 34
TianMuShan Road, Hangzhou, Zhejiang 310028, China
REFERENCE 3 (bases 1 to 5901)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5901)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-JUL-2014) Department of Chemical and Biological Engineering,
Zhejiang University, Institute of Bioengineering, 34 TianMuShan
Road, Hangzhou, Zhejiang 310028, China"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: Artificial Sequence v. Artificial Sequence
Sequencing Technology :: Artificial Sequence
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5901
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 22..55
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
misc_feature 88..1095
/label=GAL1-7 homologous arm
/note="GAL1-7 homologous arm"
terminator complement(1106..1271)
/label=ADH1 terminator
/note="transcription terminator for the S. cerevisiae
alcohol dehydrogenase 1 (ADH1) gene"
CDS complement(1419..1442)
/codon_start=1
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
/translation="DYKDDDDK"
promoter 1489..2153
/label=GAL1,10 promoter
/note="divergent inducible promoter, regulated by Gal4"
promoter 2164..2182
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 2200..2229
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
terminator 2259..2448
/label=CYC1 terminator
/note="transcription terminator for CYC1"
promoter complement(2461..2479)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind complement(2502..2535)
/label=loxP
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GCATACAT)."
gene 2581..3937
/label=kanMX
/note="yeast selectable marker conferring kanamycin
resistance (Wach et al., 1994)"
promoter 4032..4252
/label=URA3 promoter
CDS 4253..5053
/codon_start=1
/label=URA3
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
/translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
rep_origin complement(5225..5813)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.