Basic Vector Information
- Vector Name:
- pUMRI-10
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5948 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Xie W, Lv X, Yu H.
- Promoter:
- GAL1,10
pUMRI-10 vector Map
pUMRI-10 vector Sequence
LOCUS 40924_45733 5948 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pUMRI-10, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5948) AUTHORS Xie W, Lv X, Yu H. TITLE pUMRI plasmids for metabolic pathway assembly JOURNAL Unpublished REFERENCE 2 (bases 1 to 5948) AUTHORS Xie W, Lv X, Yu H. TITLE Direct Submission JOURNAL Submitted (21-JUL-2014) Department of Chemical and Biological Engineering, Zhejiang University, Institute of Bioengineering, 34 TianMuShan Road, Hangzhou, Zhejiang 310028, China REFERENCE 3 (bases 1 to 5948) TITLE Direct Submission REFERENCE 4 (bases 1 to 5948) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-JUL-2014) Department of Chemical and Biological Engineering, Zhejiang University, Institute of Bioengineering, 34 TianMuShan Road, Hangzhou, Zhejiang 310028, China" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: Artificial Sequence v. Artificial Sequence Sequencing Technology :: Artificial Sequence ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5948 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 22..55 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." CDS complement(1078..1089) /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" terminator complement(1153..1318) /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" CDS complement(1466..1489) /codon_start=1 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" /translation="DYKDDDDK" promoter 1536..2200 /label=GAL1,10 promoter /note="divergent inducible promoter, regulated by Gal4" promoter 2211..2229 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 2247..2276 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" terminator 2306..2495 /label=CYC1 terminator /note="transcription terminator for CYC1" promoter complement(2508..2526) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(2549..2582) /label=Loxp site /note="Loxp site" protein_bind complement(2549..2582) /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." gene 2628..3984 /label=kanMX /note="yeast selectable marker conferring kanamycin resistance (Wach et al., 1994)" promoter 4079..4299 /label=URA3 promoter CDS 4300..5100 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" rep_origin complement(5272..5860) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.