pUMat-attB-GFP vector (V002286)

Download GeneBank File(.gb)

LOCUS       40924_45723       10443 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pUMat-attB-GFP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10443)
  AUTHORS   Irion U.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAY-2018) ECNV, Max Planck Institute for Developmental
            Biology, Max-Planck-Ring 5, Tuebingen 72076, Germany
REFERENCE   2  (bases 1 to 10443)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 10443)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted 
            (16-MAY-2018) ECNV, Max Planck Institute for Developmental Biology, 
            Max-Planck-Ring 5, Tuebingen 72076, Germany"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10443
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      4..459
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        623..641
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     gene            666..4802
                     /label=mini-white
                     /note="This modified version of the white gene lacks part
                     of the first intron."
     regulatory      4808..6803
                     /gene="alpha Tub67C"
                     /label=promoter from Drosophila melanogaster
                     /note="promoter from Drosophila melanogaster"
                     /regulatory_class="promoter"
     gene            4808..6803
                     /gene="alpha Tub67C"
                     /label=alpha Tub67C
     CDS             6819..7640
                     /codon_start=1
                     /product="mGFP6"
                     /label=mGFP6
                     /protein_id="AYK27211.1"
                     /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKA
                     NFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALDPNEKRDHMVLLEFV
                     TAAGITHGMDELYKLEVDGIDKLDIEFLQPGGSHMRSRPTSSRACSPGDPI"
     primer_bind     7529..7545
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      7690..7934
                     /label=alphaTub84B 3'UTR
                     /note="alphaTub84B 3'UTR"
                     /regulatory_class="terminator"
     protein_bind    7967..8036
                     /label=attB
                     /note="attB site for the phi-C31 integrase (Groth et al.,
                     2000)"
     promoter        complement(8255..8273)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(8294..8310)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    8318..8334
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8342..8372)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(8387..8408)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(8696..9284)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9458..10315)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(10316..10420)
                     /label=AmpR promoter