pUK21deltaBB vector (V002288)

LOCUS       40924_45713        3018 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pUK21deltaBB, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3018)
  AUTHORS   Voth WP, Richards JD, Shaw JM, Stillman DJ.
  TITLE     Yeast vectors for integration at the HO locus
  JOURNAL   Nucleic Acids Res. 29 (12), E59 (2001)
  PUBMED    11410682
REFERENCE   2  (bases 1 to 3018)
  AUTHORS   Voth WP, Stillman DJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2000) Pathology, University of Utah, 50 N. Medical
            Drive, 5C124 SOM, Salt Lake City, UT 84132, USA
REFERENCE   3  (bases 1 to 3018)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3018)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic 
            Acids Res."; date: "2001"; volume: "29"; issue: "12"; pages: "E59"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (29-NOV-2000) Pathology, University of Utah, 50 N. Medical Drive, 
            5C124 SOM, Salt Lake City, UT 84132, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3018
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     61..77
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(92..110)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(117..133)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             1085..1885
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="RETSCSTRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKPDA
                     PELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQ
                     VLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFD
                     DERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRY
                     QDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      2031..2619
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    2907..2928
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     protein_bind    2983..2999
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."