pUK21 vector (Cat. No.: V002289)
- Name:
- pUK21
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3090 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vieira J, Messing J.
- Growth Strain(s):
- Top10
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pUK21 vector (Cat. No.: V002289) Sequence
LOCUS 40924_45708 3090 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pUK21, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3090)
AUTHORS Vieira J, Messing J.
TITLE New pUC-derived cloning vectors with different selectable markers
and DNA replication origins
JOURNAL Gene 100, 189-194 (1991)
PUBMED 1905257
REFERENCE 2 (bases 1 to 3090)
AUTHORS Vieira J, Messing J.
TITLE Direct Submission
JOURNAL Submitted (12-JAN-2000) Waksman Institute, Rutgers University, 190
Frelinghuysen Road, Piscataway, NJ 08854, USA
REFERENCE 3 (bases 1 to 3090)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3090)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene 100,
189-194 (1991)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-JAN-2000) Waksman Institute, Rutgers University, 190
Frelinghuysen Road, Piscataway, NJ 08854, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3090
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 107..128
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
protein_bind 183..199
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 207..223
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
primer_bind 351..367
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(382..400)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(407..423)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS 1375..2175
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="RETSCSTRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKPDA
PELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQ
VLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFD
DERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRY
QDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 2321..2909
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"