Basic Vector Information
- Vector Name:
- pUK21
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3090 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Vieira J, Messing J.
pUK21 vector Map
pUK21 vector Sequence
LOCUS 40924_45708 3090 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pUK21, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3090) AUTHORS Vieira J, Messing J. TITLE New pUC-derived cloning vectors with different selectable markers and DNA replication origins JOURNAL Gene 100, 189-194 (1991) PUBMED 1905257 REFERENCE 2 (bases 1 to 3090) AUTHORS Vieira J, Messing J. TITLE Direct Submission JOURNAL Submitted (12-JAN-2000) Waksman Institute, Rutgers University, 190 Frelinghuysen Road, Piscataway, NJ 08854, USA REFERENCE 3 (bases 1 to 3090) TITLE Direct Submission REFERENCE 4 (bases 1 to 3090) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene 100, 189-194 (1991)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-JAN-2000) Waksman Institute, Rutgers University, 190 Frelinghuysen Road, Piscataway, NJ 08854, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3090 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 107..128 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." protein_bind 183..199 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 207..223 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" primer_bind 351..367 /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(382..400) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(407..423) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 1375..2175 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="RETSCSTRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKPDA PELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTAFQ VLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASDFD DERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIADRY QDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2321..2909 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.