pUDC082 vector (V002349)

Download GeneBank File(.gb)

LOCUS       V002349                10005 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002349
VERSION     V002349
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10005)
  AUTHORS   Beekwilder J, van Rossum H.
  TITLE     Production of carotenoids in Saccharomyces cerevisiae by a
            self-processing polyprotein and conversion to beta-ionone
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10005)
  AUTHORS   Beekwilder J, van Rossum H.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2013) BU Bioscience, Plant Research International,
            P.O.Box 619, Wageningen, Gelderland 6700AP, Netherlands
REFERENCE   3  (bases 1 to 10005)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10005)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: IDBA v. 1
            Coverage              :: 160
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (13-SEP-2013) BU Bioscience, Plant Research International, P.O.Box
            619, Wageningen, Gelderland 6700AP, Netherlands"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10005
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        7..650
                     /label="GAP promoter"
                     /note="promoter for glyceraldehyde-3-phosphate
                     dehydrogenase; also known as the TDH3 promoter"
     primer_bind     656..672
                     /label="SK primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             674..2692
                     /gene="crtYB"
                     /label="Bifunctional lycopene cyclase/phytoene synthase"
                     /note="Bifunctional lycopene cyclase/phytoene synthase from
                     Phaffia rhodozyma. Accession#: Q7Z859"
     CDS             2699..2752
                     /label="T2A"
                     /note="2A peptide from Thosea asigna virus capsid protein"
     misc_feature    2753..4495
                     /note="phytoene desaturase from Xanthophyllomyces
                     dendrorhous; Region: CrtI"
     misc_feature    4496..4555
                     /label="Region: T2A ribosomal skipping sequence"
                     /note="Region: T2A ribosomal skipping sequence"
     CDS             4502..4555
                     /codon_start=1
                     /product="2A peptide from Thosea asigna virus capsid
                     protein"
                     /label="T2A"
                     /note="Eukaryotic ribosomes fail to insert a peptide bond
                     between the Gly and Pro residues, yielding separate
                     polypeptides."
                     /translation="EGRGSLLTCGDVEENPGP"
     CDS             5091..5102
                     /label="Factor Xa site"
                     /note="Factor Xa recognition and cleavage site"
     terminator      5748..5945
                     /label="TEF terminator"
                     /note="Ashbya gossypii TEF terminator"
     CDS             6439..7242
                     /codon_start=1
                     /product="orotidine-5'-phosphate decarboxylase"
                     /label="orotidine-5'-phosphate decarboxylase"
                     /note="URA3; derived from Kluyveromyces lactis"
                     /protein_id="AHZ97959.1"
                     /translation="MSTKSYTSRAETHASPVASKLLRLMDEKKTNLCASLDVRSTDELL
                     KLVETLGPYICLLKTHVDILDDFSYEGTVVPLKALAEKYKFLIFEDRKFADIGNTVKLQ
                     YTSGVYRIAEWSDITNAHGVTGAGIVAGLKQGAQEVTKEPRGLLMLAELSSKGSLAHGE
                     YTKGTVDIAKSDKDFVIGFIAQNDMGGREEGFDWLIMTPGVGLDDKGDALGQQYRTVDE
                     VVSGGSDIIIVGRGLFAKGRDPKVEGERYRNAGWEAYQKRISAPH"
     promoter        7426..7530
                     /label="AmpR promoter"
     CDS             7531..8388
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      8562..9150
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    complement(9422..9925)
                     /label="CEN/ARS"
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"