Basic Vector Information
- Vector Name:
- pUDC082
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10005 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Beekwilder J, van Rossum H.
- Promoter:
- GPD
pUDC082 vector Map
pUDC082 vector Sequence
LOCUS V002349 10005 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V002349 VERSION V002349 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10005) AUTHORS Beekwilder J, van Rossum H. TITLE Production of carotenoids in Saccharomyces cerevisiae by a self-processing polyprotein and conversion to beta-ionone JOURNAL Unpublished REFERENCE 2 (bases 1 to 10005) AUTHORS Beekwilder J, van Rossum H. TITLE Direct Submission JOURNAL Submitted (13-SEP-2013) BU Bioscience, Plant Research International, P.O.Box 619, Wageningen, Gelderland 6700AP, Netherlands REFERENCE 3 (bases 1 to 10005) TITLE Direct Submission REFERENCE 4 (bases 1 to 10005) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: IDBA v. 1 Coverage :: 160 Sequencing Technology :: Illumina ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-SEP-2013) BU Bioscience, Plant Research International, P.O.Box 619, Wageningen, Gelderland 6700AP, Netherlands" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10005 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 7..650 /label="GAP promoter" /note="promoter for glyceraldehyde-3-phosphate dehydrogenase; also known as the TDH3 promoter" primer_bind 656..672 /label="SK primer" /note="common sequencing primer, one of multiple similar variants" CDS 674..2692 /gene="crtYB" /label="Bifunctional lycopene cyclase/phytoene synthase" /note="Bifunctional lycopene cyclase/phytoene synthase from Phaffia rhodozyma. Accession#: Q7Z859" CDS 2699..2752 /label="T2A" /note="2A peptide from Thosea asigna virus capsid protein" misc_feature 2753..4495 /note="phytoene desaturase from Xanthophyllomyces dendrorhous; Region: CrtI" misc_feature 4496..4555 /label="Region: T2A ribosomal skipping sequence" /note="Region: T2A ribosomal skipping sequence" CDS 4502..4555 /codon_start=1 /product="2A peptide from Thosea asigna virus capsid protein" /label="T2A" /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="EGRGSLLTCGDVEENPGP" CDS 5091..5102 /label="Factor Xa site" /note="Factor Xa recognition and cleavage site" terminator 5748..5945 /label="TEF terminator" /note="Ashbya gossypii TEF terminator" CDS 6439..7242 /codon_start=1 /product="orotidine-5'-phosphate decarboxylase" /label="orotidine-5'-phosphate decarboxylase" /note="URA3; derived from Kluyveromyces lactis" /protein_id="AHZ97959.1" /translation="MSTKSYTSRAETHASPVASKLLRLMDEKKTNLCASLDVRSTDELL KLVETLGPYICLLKTHVDILDDFSYEGTVVPLKALAEKYKFLIFEDRKFADIGNTVKLQ YTSGVYRIAEWSDITNAHGVTGAGIVAGLKQGAQEVTKEPRGLLMLAELSSKGSLAHGE YTKGTVDIAKSDKDFVIGFIAQNDMGGREEGFDWLIMTPGVGLDDKGDALGQQYRTVDE VVSGGSDIIIVGRGLFAKGRDPKVEGERYRNAGWEAYQKRISAPH" promoter 7426..7530 /label="AmpR promoter" CDS 7531..8388 /label="AmpR" /note="beta-lactamase" rep_origin 8562..9150 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(9422..9925) /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.