pUCYIT356N vector (V002350)

Download GeneBank File(.gb)

LOCUS       V002350                 4818 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V002350
VERSION     V002350
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 4818)
  AUTHORS   Kushiro A, Kiwaki M, Shimizu K.
  TITLE     A cryptic plasmid of Lactobacillus casei and construction of shuttle
            vector and food-grade vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4818)
  AUTHORS   Kushiro A, Kiwaki M, Shimizu K.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-SEP-2003) Akira Kushiro, Yakult Central Institute for
            Microbiological Research, Clinical Microbiology; 1796, Yaho,
            Kunitachi, Tokyo 186-8650, Japan (E-mail:akira-kushiro@yakult.co.jp,
            Tel:81-42-577-8962(ex.2403), Fax:81-42-577-3020)
REFERENCE   3  (bases 1 to 4818)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4818)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (05-SEP-2003) Akira Kushiro, Yakult Central Institute for
            Microbiological Research, Clinical Microbiology"; volume: " 1796,
            Yaho, Kunitachi, Tokyo 186-8650, Japan
            (E-mail:akira-kushiro@yakult.co.jp, Tel:81-42-577-8962(ex.2403),
            Fax"; pages: "81-42-577-3020"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4818
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          1378..3697
                     /plasmid="pYIT356"
                     /mol_type="other DNA"
                     /db_xref="taxon:1582"
                     /organism="Lactobacillus casei"
     regulatory      176..181
                     /regulatory_class="minus_35_signal"
     regulatory      203..208
                     /regulatory_class="minus_10_signal"
     CDS             264..998
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"
     primer_bind     1308..1324
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     repeat_region   2056..2076
                     /label="DR1"
                     /note="DR1"
     repeat_region   2065..2080
     repeat_region   2077..2097
                     /label="DR2"
                     /note="DR2"
     repeat_region   2086..2101
     repeat_region   2098..2118
                     /label="DR3"
                     /note="DR3"
     repeat_region   2107..2122
     repeat_region   2119..2139
                     /label="DR4"
                     /note="DR4"
     repeat_region   2128..2143
                     /rpt_unit_range=2128 .. 2143
     regulatory      2152..2157
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /regulatory_class="minus_35_signal"
     regulatory      2175..2180
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /regulatory_class="minus_10_signal"
     CDS             2224..3036
                     /codon_start=1
                     /gene="repB"
                     /product="Replication protein"
                     /label="repB"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="BAD42833.1"
                     /translation="MNVALAGLLDRQDYLVTQANDLARSLGNLSTFQHKVLDYCFSYVT
                     ANDNANTVYHLTTLEIIHHLGLNTSGDSYKRVVKAFKALNENTAIYMRTTEPDGKHGIL
                     MTSLFAYIKVIDDGRVEFKFSATVAPFVFQLKRQFYSFHLSELTRVRSKYTLSMMKLWN
                     ANAIGKWRDQNDPSSLPPAATIKGSLTDWESWFLGSDDDGKPIKWPAGRFKQKAIDVAI
                     KELGSLYPQTMINVLRLTHGRRIEGFQIEFRPIRTVLDLNPQVIDGKP"
     gene            2224..3036
                     /gene="repB"
                     /label="repB"
     primer_bind     complement(3718..3734)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(3742..3758)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3766..3796)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3811..3832)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(4120..4708)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"