Basic Vector Information
- Vector Name:
- pUCP30T-E2Crimson
- Antibiotic Resistance:
- Gentamycin
- Length:
- 5169 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Barbier M, Damron FH.
- Promoter:
- Pc
pUCP30T-E2Crimson vector Map
pUCP30T-E2Crimson vector Sequence
LOCUS 40924_45363 5169 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pUCP30T-E2Crimson, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5169) AUTHORS Barbier M, Damron FH. TITLE Rainbow Vectors for Broad-Range Bacterial Fluorescence Labeling JOURNAL PLoS ONE 11 (3), E0146827 (2016) PUBMED 26937640 REFERENCE 2 (bases 1 to 5169) AUTHORS Barbier M, Damron FH. TITLE Direct Submission JOURNAL Submitted (06-OCT-2015) Microbiology, Immunology and Cell Biology, West Virginia University, School of Medicine, One Medical Center Drive, Morgantown, WV 26506, USA REFERENCE 3 (bases 1 to 5169) TITLE Direct Submission REFERENCE 4 (bases 1 to 5169) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2016"; volume: "11"; issue: "3"; pages: "E0146827" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-OCT-2015) Microbiology, Immunology and Cell Biology, West Virginia University, School of Medicine, One Medical Center Drive, Morgantown, WV 26506, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5169 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 72..660 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" oriT complement(732..840) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind 1224..1245 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1260..1290 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1298..1314 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1322..1338 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1518..2192 /codon_start=1 /label=E2-Crimson /note="far-red noncytotoxic tetrameric variant of DsRed fluorescent protein (Strack et al., 2009)" /translation="MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGVGEGKPYEGTQTAK LQVTKGGPLPFAWDILSPQFFYGSKAYIKHPADIPDYLKQSFPEGFKWERVMNFEDGGV VTVTQDSSLQDGTLIYHVKFIGVNFPSDGPVMQKKTLGWEPSTERNYPRDGVLKGENHM ALKLKGGGHYLCEFKSIYMAKKPVKLPGYHYVDYKLDITSHNEDYTVVEQYERAEARHH LFQ" primer_bind complement(2274..2290) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(2454..3284) /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" rep_origin 3298..3649 /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" promoter 3690..3718 /label=Pc promoter /note="class 1 integron promoter" CDS 3907..4437 /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT"
This page is informational only.