Basic Vector Information
- Vector Name:
- pUChTNFR75f
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5095 bp
- Type:
- Bacterial expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pUChTNFR75f vector Map
pUChTNFR75f vector Sequence
LOCUS 40924_45273 5095 bp DNA circular SYN 18-DEC-2018 DEFINITION Bacterial expression vector pUChTNFR75f, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5095) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5095) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5095) TITLE Direct Submission REFERENCE 4 (bases 1 to 5095) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5095 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(403..1512) /label=3UTR /note="3UTR" CDS complement(1513..2803) /codon_start=1 /note="unnamed protein product; TNFRf" /protein_id="SJL88754.1" /translation="RPGAREHMPAQRIL*PDSSDVLQQMLAGPTCKSLLYQDLGHRV*L L*GQHIHPALELGSRVLELWLPL*L*PGGNSSLHSGTEPHLHLQARLVLRAEQAGGVPA VRAAAQVPPGLRRGQTRN*NIRRGVQALCPGDVLQHDFIHGYLQAPPDL*RGGHPWECK HGCSLHVHVPHPEYGPRGSTLTPASVHTIPTHAANSRTQHCSKHLLPAPNGPQPPS*RE HWRLRSSSWTDCGCDSLGSTNNRSGELCHHDPGEKEALVPAERSQGASLACR*GPGYTG PRAAAPADHSAELQQQLPGELGQCVGQKGAHSEPATGTRRGGQWGRGGPGQHRELRFFP WWPWDPGQCHLHRERL*QL*PQLTVLLPSQLHNGRHRFQPLGVPEGRAGPLLQGGMCLS VTAGDARDPAGEHRREAPAPWSA*CWDEAQL" misc_feature 2805..2861 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(2874..2890) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2898..2914) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2922..2952) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2967..2988) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(3276..3864) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4038..4895) /label=AmpR /note="beta-lactamase" promoter complement(4896..5000) /label=AmpR promoter
This page is informational only.