Basic Vector Information
- Vector Name:
- pUCAG.MEF2C
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6382 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- van Tuyn J, Pijnappels DA, de Vries AA, de Vries I, van der Velde-van Dijke I, Knaan-Shanzer S, van der Laarse A, Schalij MJ, Atsma DE.
- Promoter:
- chicken β-actin
pUCAG.MEF2C vector Vector Map
pUCAG.MEF2C vector Sequence
LOCUS 40924_45223 6382 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pUCAG.MEF2C, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6382) AUTHORS van Tuyn J, Pijnappels DA, de Vries AA, de Vries I, van der Velde-van Dijke I, Knaan-Shanzer S, van der Laarse A, Schalij MJ, Atsma DE. TITLE Fibroblasts from human postmyocardial infarction scars acquire properties of cardiomyocytes after transduction with a recombinant myocardin gene JOURNAL FASEB J. 21 (12), 3369-3379 (2007) PUBMED 17579192 REFERENCE 2 (bases 1 to 6382) AUTHORS van Tuyn J. TITLE Direct Submission JOURNAL Submitted (13-DEC-2006) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2300 RC, Netherlands REFERENCE 3 (bases 1 to 6382) TITLE Direct Submission REFERENCE 4 (bases 1 to 6382) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "FASEB J."; date: "2007"; volume: "21"; issue: "12"; pages: "3369-3379" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-DEC-2006) MCB, LUMC, Einthovenweg 20, Leiden, ZH 2300 RC, Netherlands" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6382 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 1..17 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" regulatory 68..448 /label=CMV.IE enhancer /note="CMV.IE enhancer" /regulatory_class="enhancer" enhancer 68..447 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 450..725 /label=chicken beta-actin promoter intron 726..1734 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" CDS 1854..3155 /codon_start=1 /gene="MEF2C" /product="Homo sapiens MEF2C" /label=MEF2C /protein_id="ABM67540.1" /translation="MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL IIFNSTNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDAD DSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSS LGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS PGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINNSQSAQ SLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVT GWQQQHLHNMPPSALSQLGDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDH RNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT" gene 1854..3155 /gene="MEF2C" /label=MEF2C polyA_signal 3351..3406 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(3783..3799) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 4273..4377 /label=AmpR promoter CDS 4378..5235 /label=AmpR /note="beta-lactamase" rep_origin 5409..5997 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 6285..6306 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6321..6351 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6359..6375 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.