Basic Vector Information
- Vector Name:
- pUC18VcluxOR
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4186 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Kasai S.
pUC18VcluxOR vector Map
pUC18VcluxOR vector Sequence
LOCUS 40924_45123 4186 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pUC18VcluxOR DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4186) AUTHORS Kasai S. TITLE Freshwater bioluminescence in Vibrio albensis (Vibrio cholerae biovar albensis) NCIMB 41 is caused by a two-nucleotide deletion in luxO JOURNAL J. Biochem. 139 (3), 471-482 (2006) PUBMED 16567412 REFERENCE 2 (bases 1 to 4186) AUTHORS Kasai S. TITLE Direct Submission JOURNAL Submitted (16-SEP-2005) Contact:Sabu Kasai Graduate School of Engineering, Osaka City University, Department of Applied Chemistry and Bioapplied Chemistry; Sugimoto 3-3-138, Sumiyoshi-ku, Osaka 558-8585, Japan REFERENCE 3 (bases 1 to 4186) TITLE Direct Submission REFERENCE 4 (bases 1 to 4186) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biochem."; date: "2006"; volume: "139"; issue: "3"; pages: "471-482" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-SEP-2005) Contact:Sabu Kasai Graduate School of Engineering, Osaka City University, Department of Applied Chemistry and Bioapplied Chemistry; Sugimoto 3-3-138, Sumiyoshi-ku, Osaka 558-8585, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4186 /mol_type="other DNA" /organism="synthetic DNA construct" source 2259..3783 /strain="NCIMB 41" /mol_type="other DNA" /note="biovar:albensis; synonym: Vibrio cholerae bv. albensis" /db_xref="taxon:140100" /organism="Vibrio albensis" promoter 96..200 /label=AmpR promoter CDS 201..1058 /label=AmpR /note="beta-lactamase" rep_origin 1232..1820 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 2108..2129 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2144..2174 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2182..2198 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2206..2222 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2412..3779 /codon_start=1 /gene="luxO" /product="LuxO" /label=luxO /note="derived from Vibrio cholerae biovar albensis lux0 gene, deposited in Acc# AB114423, a two nucleotide deletion is recoverd" /protein_id="BAE87124.1" /translation="MVEDTASVAALYRSYLTPLDIDINIVGTGRDAIESIGRREPDLIL LDLRLPDMTGMDVLYAVKEKSPDVPIVFMTAHGSIDTAVEAMRHGTQDFLIKPCEADRL RVTVNNAIRKASKLKNDVDNKNQNYQGFIGSSQTMQAVSRTIDSAASSKASIFITGESG TGKEVCAEAIHAASKRGDKPFIAINCAAIPKDLIESELFGHVKGAFTGAATERQGAAEA ADGGTLFLDELCEMDLDLQTKLLRFIQTGTFQKVGSSKMKSVDVRFVCATNRDPWKEVQ EGRFREDLYYRLYVIPLHLPPLRARGDDVIEIAYSLLGFMSKEEGKDFVRLSAEVVERF RQYEWPGNVRQLQNVLRNVVVLNEGREITLDMLPPPLNQMSVPINRALPLAHENKVSVH EIFPLWMTEKQAIEQAIEACDGNIPRAATYLDVSPSTIYRKLQTWNEKVKEKEKER" gene 2412..3779 /gene="luxO" /label=luxO primer_bind complement(3792..3808) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.