Basic Vector Information
- Vector Name:
- pUC18T-mini-Tn7T-aad9
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4602 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Lehman SS, Mladinich K, Boonyakanog A, Mima T, Karkhoff-Schweizer RR, Schweizer HP.
pUC18T-mini-Tn7T-aad9 vector Vector Map
pUC18T-mini-Tn7T-aad9 vector Sequence
LOCUS 40924_45053 4602 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pUC18T-mini-Tn7T-aad9, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4602) AUTHORS Lehman SS, Mladinich K, Boonyakanog A, Mima T, Karkhoff-Schweizer RR, Schweizer HP. TITLE Versatile nourseothricin and streptomycin/spectinomycin resistance gene cassettes and their use in chromosome integration vectors JOURNAL Unpublished REFERENCE 2 (bases 1 to 4602) AUTHORS Lehman SS, Mladinich K, Boonyakanog A, Mima T, Karkhoff-Schweizer RR, Schweizer HP. TITLE Direct Submission JOURNAL Submitted (17-MAR-2016) Molecular Genetics and Microbiology, University of Florida, 2055 Mowry Road, Gainesville, FL 32610, USA REFERENCE 3 (bases 1 to 4602) TITLE Direct Submission REFERENCE 4 (bases 1 to 4602) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-MAR-2016) Molecular Genetics and Microbiology, University of Florida, 2055 Mowry Road, Gainesville, FL 32610, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4602 /mol_type="other DNA" /organism="synthetic DNA construct" mobile_element 382..580 /mobile_element_type="transposon:Tn7R" /label=n7R /note="right end of Tn7" primer_bind 585..601 /label=KS primer /note="common sequencing primer, one of multiple similar variants" terminator 629..723 /label=lambda t0 terminator /note="transcription terminator from phage lambda" terminator 826..912 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" protein_bind 955..988 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." regulatory 1024..1067 /regulatory_class="terminator" CDS complement(1066..1818) /codon_start=1 /gene="aad9" /product="spectinomycin adenyltransferase" /label=aad9 /protein_id="ANY60780.1" /translation="MNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNSDLDFL VVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYG EWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMD SSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERILLAVR SYLGENIEWTNENVNLTINYLNNRLKKL" gene complement(1066..1818) /gene="aad9" /label=aad9 /note="derived from Enterococcus faecalis" regulatory 1825..1830 /regulatory_class="ribosome_binding_site" regulatory 1872..1900 /label=chloramphenicol transacetylase gene promoter /note="chloramphenicol transacetylase gene promoter" /regulatory_class="promoter" regulatory 1872..1877 /regulatory_class="minus_10_signal" regulatory 1894..1900 /regulatory_class="minus_35_signal" misc_feature 1985..2017 /note="loxP; Cre recombinase site" misc_feature 2033..2107 /note="MCS; multiple cloning site" mobile_element complement(2119..2284) /label=Tn7L /note="mini-Tn7 element (left end of the Tn7 transposon)" oriT complement(2443..2551) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin complement(2783..3371) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3545..4402) /label=AmpR /note="beta-lactamase" promoter complement(4403..4507) /label=AmpR promoter
This page is informational only.