pUAST-CTAP vector (V002466)

Basic Vector Information

Vector Name:
pUAST-CTAP
Antibiotic Resistance:
Ampicillin
Length:
9627 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Veraksa A, Bauer A, Artavanis-Tsakonas S.
Promoter:
hsp70

pUAST-CTAP vector Map

pUAST-CTAP9627 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400880092009600oriAmpRAmpR promoterP element 3' end5X UAShsp70 promoterpolylinker; unique cloning sites for EcoRI, EagI/NotI, XhoI, KpnI, XbaI; XbaI site is dam methylation sensitiveCBPTEV siteProtAProtAsmall t intronSV40 NLSSV40 poly(A) signalmini-whiteP element 5' end

pUAST-CTAP vector Sequence

LOCUS       40924_44744        9627 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pUAST-CTAP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9627)
  AUTHORS   Veraksa A, Bauer A, Artavanis-Tsakonas S.
  TITLE     Analyzing protein complexes in Drosophila with tandem affinity 
            purification-mass spectrometry
  JOURNAL   Dev. Dyn. 232 (3), 827-834 (2005)
  PUBMED    15704125
REFERENCE   2  (bases 1 to 9627)
  AUTHORS   Veraksa A, Bauer A, Artavanis-Tsakonas S.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-AUG-2004) MGH Cancer Center, Harvard Medical School, 
            Bldg 149, 13th Street, Charlestown, MA 02129, USA
REFERENCE   3  (bases 1 to 9627)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9627)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Dev. Dyn.";
            date: "2005"; volume: "232"; issue: "3"; pages: "827-834"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (17-AUG-2004) MGH Cancer Center, Harvard Medical School, Bldg 149, 
            13th Street, Charlestown, MA 02129, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9627
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(235..823)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(997..1854)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(1855..1959)
                     /label=AmpR promoter
     misc_feature    complement(2761..2993)
                     /label=P element 3' end
                     /note="P element 3' end"
     protein_bind    3055..3149
                     /label=5X UAS
                     /note="five tandem copies of the 'ScaI site' 17-mer 
                     CGGAGTACTGTCCTCCG, an upstream activating sequence (UAS) 
                     that efficiently binds yeast Gal4 (Webster et al., 1988; 
                     Pfeiffer et al., 2010)"
     promoter        3168..3406
                     /label=hsp70 promoter
                     /note="Drosophila melanogaster hsp70Bb promoter"
     misc_feature    3420..3465
                     /note="polylinker; unique cloning sites for EcoRI,
                     EagI/NotI, XhoI, KpnI, XbaI; XbaI site is dam methylation 
                     sensitive"
     CDS             3475..3552
                     /label=CBP
                     /note="calmodulin-binding peptide"
     CDS             3580..3600
                     /label=TEV site
                     /note="tobacco etch virus (TEV) protease recognition and 
                     cleavage site"
     CDS             3640..3813
                     /label=ProtA
                     /note="IgG-binding unit of Staphylococcus aureus protein A"
     CDS             3817..3987
                     /codon_start=1
                     /product="IgG-binding unit of Staphylococcus aureus protein
                     A"
                     /label=ProtA
                     /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLA
                     EAKKLNGAQAPK"
     intron          4103..4168
                     /label=small t intron
                     /note="SV40 (simian virus 40) small t antigen intron"
     CDS             4298..4318
                     /label=SV40 NLS
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     polyA_signal    4743..4877
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     gene            4895..9031
                     /label=mini-white
                     /note="This modified version of the white gene lacks part
                     of the first intron."
     misc_feature    complement(9042..9627)
                     /label=P element 5' end

This page is informational only.