Basic Vector Information
- Vector Name:
- pUA-At
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12347 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Zhou J, Yu F, Chen B, Wang X, Yang Y, Cheng Y, Yan C, Chen J.
- Promoter:
- CaMV35S(long)
pUA-At vector Vector Map
pUA-At vector Sequence
LOCUS 40924_44664 12347 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pUA-At, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12347) AUTHORS Zhou J, Yu F, Chen B, Wang X, Yang Y, Cheng Y, Yan C, Chen J. TITLE Universal vectors for constructing artificial microRNAs in plants JOURNAL Biotechnol. Lett. 35 (7), 1127-1133 (2013) PUBMED 23568377 REFERENCE 2 (bases 1 to 12347) AUTHORS Zhou J, Wang XM, Yan CQ, Chen JP. TITLE Direct Submission JOURNAL Submitted (22-OCT-2012) Zhejiang Provincial Key Laboratory of Plant Virology, Zhejiang Academy of Agricultural Sciences, 198 Shiqiao Road, Hangzhou, Zhejiang 310021, China REFERENCE 3 (bases 1 to 12347) TITLE Direct Submission REFERENCE 4 (bases 1 to 12347) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Lett."; date: "2013"; volume: "35"; issue: "7"; pages: "1127-1133" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-OCT-2012) Zhejiang Provincial Key Laboratory of Plant Virology, Zhejiang Academy of Agricultural Sciences, 198 Shiqiao Road, Hangzhou, Zhejiang 310021, China" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..12347 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 501..846 /label=CaMV 35S promoter /note="strong constitutive promoter from cauliflower mosaic virus" misc_feature 868..968 /label=amiRNA backbone /note="amiRNA backbone" promoter 1145..1247 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 1248..1925 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQAGRNLE DPAY" CDS 2248..2550 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VPRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" misc_feature 2620..2774 /label=amiRNA backbone /note="amiRNA backbone" terminator 2801..3442 /label=E9 terminator /note="terminator and polyadenylation signal from the pea rbcS-E9 gene" primer_bind complement(3450..3466) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 3669..3693 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS 4993..5619 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 6056..7120 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" rep_origin 7189..7383 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 7727..7867 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(8053..8641) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8731..9522) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" misc_feature 9947..9971 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" polyA_signal complement(10049..10223) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(10266..11288) /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK K" promoter complement(11356..12033) /label=CaMV 35S promoter (enhanced) /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" protein_bind 12224..12245 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 12260..12290 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 12298..12314 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 12322..12338 /label=M13 rev /note="common sequencing primer, one of multiple similar variants"
This page is informational only.