Basic Vector Information
- Vector Name:
- pTY2b
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4804 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Ohnishi N, Mukherjee B, Tsujikawa T, Yanase M, Nakano H, Moroney JV, Fukuzawa H.
- Promoter:
- T3
pTY2b vector Map
pTY2b vector Sequence
LOCUS 40924_44574 4804 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pTY2b DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4804)
AUTHORS Ohnishi N, Mukherjee B, Tsujikawa T, Yanase M, Nakano H, Moroney JV,
Fukuzawa H.
TITLE Expression of a low CO-inducible protein, LCI1, increases inorganic
carbon uptake in the green alga Chlamydomonas reinhardtii
JOURNAL Plant Cell 22 (9), 3105-3117 (2010)
PUBMED 20870960
REFERENCE 2 (bases 1 to 4804)
AUTHORS Tsujikawa T, Fukuzawa H.
TITLE Direct Submission
JOURNAL Submitted (11-JUL-2008) Contact:Hideya Fukuzawa Kyoto University,
Graduate School of Biostudies; Kitashirakawa Oiwake-cho, Kyoto,
Kyoto 606-8502, Japan URL :http://chlamy.pmb.lif.kyoto-u.ac.jp/
REFERENCE 3 (bases 1 to 4804)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4804)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant
Cell"; date: "2010"; volume: "22"; issue: "9"; pages: "3105-3117"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-JUL-2008) Contact:Hideya Fukuzawa Kyoto University, Graduate
School of Biostudies"; volume: " Kitashirakawa Oiwake-cho, Kyoto,
Kyoto 606-8502, Japan URL :http"; pages:
"//chlamy.pmb.lif.kyoto-u.ac.jp"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4804
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 24..128
/label=AmpR promoter
CDS 129..986
/label=AmpR
/note="beta-lactamase"
rep_origin 1160..1748
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 2036..2057
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2072..2102
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 2110..2126
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 2134..2150
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 2171..2189
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
regulatory 2208..2291
/note="includes enhancer region (-231 to -200 and -77 to
-25) of Chlamydomonas reinhardtii NAD(P)H nitrate reductase
protein (Nit1) gene"
/regulatory_class="enhancer"
regulatory 2292..2375
/note="includes enhancer region (-231 to -200 and -77 to
-25) of Chlamydomonas reinhardtii NAD(P)H nitrate reductase
protein (Nit1) gene"
/regulatory_class="enhancer"
regulatory 2376..2411
/note="includes promoter region (-36 to -1) of
Chlamydomonas reinhardtii beta2-tubulin (tubB2) gene"
/regulatory_class="promoter"
misc_feature 2418..2612
/note="includes intron 1 of Chlamydomonas reinhardtii
nuclear gene rbcS2 for ribulose bisphosphate
carboxylase/oxygenase small subunit"
primer_bind 2632..2648
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 2680..2863
/note="3'UTR region of Chlamydomonas reinhardtii nuclear
gene rbcS2 for ribulose bisphosphate carboxylase oxygenase
small subunit"
primer_bind complement(2945..2961)
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
regulatory 2974..3188
/note="includes promoter region of Chlamydomonas
reinhardtii nuclear gene rbcS2 for ribulose bisphosphate
carboxylase/oxygenase small subunit"
/regulatory_class="promoter"
misc_feature 3188..3333
/note="includes intron 1 from Chlamydomonas reinhardtii
rbcS2 gene"
CDS join(3334..3501,3647..3859)
/codon_start=1
/gene="ble"
/product="bleomycin resistance protein"
/label=ble
/note="derived from Streptoalloteichus hindustanus; fusion
zeocin binding protein; confers resistance to zeocin"
/protein_id="BAI39424.1"
/translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
VTLFISAVQDQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPW
GREFALRDPAGNCVHFVAEEQD"
misc_feature 3334..3501
/gene="ble"
/note="includes a fragment of Streptoalloteichus
hindustanus Ble gene"
gene 3334..3501
/gene="ble"
/label=ble
misc_feature 3502..3646
/note="includes intron 1 of Chlamydomonas reinhardtii rbcS2
gene"
misc_feature 3647..3859
/gene="ble"
/note="includes a fragment of Streptoalloteichus
hindustanus Ble gene and stop codon"
gene 3647..3859
/gene="ble"
/label=ble
promoter complement(4161..4179)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(4189..4205)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin 4347..4802
/direction=RIGHT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
This page is informational only.