Basic Vector Information
- Vector Name:
- pTVP1GFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5514 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Garcia-Fruitos E, Gonzalez-Montalban N, Morell M, Vera A, Ferraz RM, Aris A, Ventura S, Villaverde A.
pTVP1GFP vector Vector Map
pTVP1GFP vector Sequence
LOCUS 40924_44524 5514 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pTVP1GFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5514) AUTHORS Garcia-Fruitos E, Gonzalez-Montalban N, Morell M, Vera A, Ferraz RM, Aris A, Ventura S, Villaverde A. TITLE Aggregation as bacterial inclusion bodies does not imply inactivation of enzymes and fluorescent proteins JOURNAL Microb. Cell Fact. 4, 27 (2005) PUBMED 16156893 REFERENCE 2 (bases 1 to 5514) AUTHORS Garcia-Fruitos E. TITLE Direct Submission JOURNAL Submitted (15-JUL-2014) Institut de Biotecnologia i de Biomedicina, CIBER-BBN, Autonomous University of Barcelona, Campus Bellaterra, Bellaterra 08193, Spain REFERENCE 3 (bases 1 to 5514) TITLE Direct Submission REFERENCE 4 (bases 1 to 5514) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microb. Cell Fact. 4, 27 (2005)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JUL-2014) Institut de Biotecnologia i de Biomedicina, CIBER-BBN, Autonomous University of Barcelona, Campus Bellaterra, Bellaterra 08193, Spain" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5514 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 193..222 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 230..246 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 909..1619 /codon_start=1 /label=GFPuv /note="GFP variant optimized for excitation by UV light" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKAN FKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELYK" terminator 1867..1953 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 2045..2072 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 2092..2183 /label=AmpR promoter CDS 2184..3041 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPTAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 3215..3803 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(3989..4129) /label=bom /note="basis of mobility region from pBR322" promoter 4315..4392 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 4393..5472 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ"
This page is informational only.